KEGG   Dendrobium catenatum: 110106772Help
Entry
110106772         CDS       T05027                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53 isoform X1
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
dct  Dendrobium catenatum
Brite
KEGG Orthology (KO) [BR:dct00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dct03009]
    110106772
Enzymes [BR:dct01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110106772
Ribosome biogenesis [BR:dct03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    110106772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL Nuc_deoxyri_tr2
Motif
Other DBs
NCBI-GeneID: 110106772
NCBI-ProteinID: XP_020692440
LinkDB All DBs
Position
Unknown
AA seq 536 aa AA seqDB search
MAFWGVEIRPSKPYIHNFDQSRGRLRISQATLGDGKSTSRSTMQCNVGDKSPVLLCSLIP
NVSETCHLELEFEEDGEVIFSVLGQRSIHLTGYYLGHGRSLDGDDTESYGEDIAESDASD
SYSYGSEDDYESDFIDDADVAIYSESRRPKSSVVIEEIEDDEKQHRNFRRLKKKHEISDS
EDVEMGSQQLVVRNKGSTKEESEDDDGFPICFTEEGTISKKKKSDDKKRKVNGSTQDTVS
VSKANTDRDSRMPAETASKHNEKSKKKKENDEKRSIGSENEEKQNKHKENVNVENNSETD
TNLSKEIEGHAKESLNGVKDTDKSGDPDACKQSKKKSKKRRISEGASDEQDSFMEDIDAD
KIPKEDKMTVDEPAATDVNVTKKKKKSKKKNKDSDIKHEALAKEKADLAVNGVDELKQGS
QAIKTRTFPNGLIVEEVSMGKPDGKKASPGKKVSVRYIGKLKSGTIFDSNIGQKPFKFRL
GIGEVIKGWDIGVSGMCVGDKRRLTIPPSFGYGAKGVGKIPPNSWLVFDVELVDVQ
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggctttttggggtgttgaaatcaggccttctaaaccgtatattcataattttgatcaa
tcccgcggcaggcttcgcatctctcaggcaacactaggtgatggtaaatctacatccagg
agcaccatgcagtgcaatgttggcgacaaaagccctgttttactgtgcagtttgattccc
aatgtatctgaaacttgccatttggaattggagtttgaagaggatggagaagtcatcttc
tctgtccttgggcagagaagcatccacttaactggctattatcttggccatggacgcagc
ttggatggagatgatactgaatcctatggggaagatattgctgaatctgatgcttctgat
agctatagttatggcagtgaagatgactatgagtctgattttatagatgatgctgatgtt
gcaatatactcagaatctcggaggcccaaaagcagcgttgtgattgaggagattgaagat
gatgaaaaacaacatcgcaacttccgtcgcctaaaaaagaagcatgagattagtgattct
gaggatgttgaaatgggatcccagcagcttgttgtaaggaacaaaggatctacaaaagag
gaaagtgaagatgatgatggttttcccatttgtttcaccgaggagggtacaatttccaaa
aagaagaaaagtgatgataagaaaaggaaggttaatggcagtactcaagataccgtttct
gttagtaaagctaatacagatcgcgattccaggatgccagctgaaactgcttctaaacat
aatgaaaaatcaaagaaaaagaaggaaaatgatgaaaagcgttctataggatctgagaat
gaagagaaacagaataagcataaggaaaatgtcaacgtggaaaacaattctgaaactgat
actaatctttcaaaagaaattgaaggtcatgctaaggaaagcctaaatggagttaaagat
actgacaagtctggtgatcctgatgcctgcaagcagagtaagaaaaaatccaaaaagaga
aggattagtgaaggtgcgtctgatgagcaagactcgttcatggaagacattgacgctgat
aaaataccaaaagaggacaaaatgactgtggatgaacctgctgctactgacgtaaatgtc
acgaagaaaaagaagaaaagcaagaaaaagaataaagattctgatataaagcatgaggca
ttagcaaaggagaaagctgacctagcggtgaatggtgttgatgaattgaagcaaggatct
caagctatcaaaactcgaacttttcctaatggtcttattgtagaggaagtttctatgggt
aaaccagatggcaaaaaggcctctcctgggaagaaggtatcagttcgctatattggcaaa
ttaaaaagcggaactatttttgattcaaacattggtcaaaaacctttcaagttccgactt
ggcattggtgaagttatcaagggatgggatataggtgttagcggcatgtgtgttggtgac
aagagaaggcttactattcctccatcattcggttatggggctaaaggtgtagggaagatt
ccaccaaactcttggcttgtgtttgacgttgagttggttgatgtgcagtga

DBGET integrated database retrieval system