KEGG   Dendrobium officinale: 110110983Help
Entry
110110983         CDS       T05027                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2-like
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
dct  Dendrobium officinale
Pathway
dct00220  Arginine biosynthesis
dct00250  Alanine, aspartate and glutamate metabolism
dct00260  Glycine, serine and threonine metabolism
dct00630  Glyoxylate and dicarboxylate metabolism
dct00710  Carbon fixation in photosynthetic organisms
dct01100  Metabolic pathways
dct01110  Biosynthesis of secondary metabolites
dct01200  Carbon metabolism
dct01210  2-Oxocarboxylic acid metabolism
dct01230  Biosynthesis of amino acids
Module
dct_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
dct_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110110983
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110110983
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110110983
   00260 Glycine, serine and threonine metabolism
    110110983
   00220 Arginine biosynthesis
    110110983
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dct01007]
    110110983
Enzymes [BR:dct01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     110110983
    2.6.1.4  glycine transaminase
     110110983
    2.6.1.44  alanine---glyoxylate transaminase
     110110983
Amino acid related enzymes [BR:dct01007]
 Aminotransferase (transaminase)
  Class I
   110110983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 110110983
NCBI-ProteinID: XP_020698310
LinkDB All DBs
Position
Unknown
AA seq 481 aa AA seqDB search
MPPKPLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLEDPNVALLFPADAIARAKHYLSMTSGGLGAYSDSRGLPGIRNEIAEFI
KRRDGYPSDPELIFLTDGASKGVMQMLNSIIRNDRDGILVPVPQYPLYSATISLYGGSLV
PYYLEEEENWGLDLDNVKKSVATARANGITIRAMVIINPGNPTGQCLSEANLKEILLFCY
RENLVLLADEVYQQNIYQDERPFISARKILLDMGPPISKEVQLVSFHTVSKGYWGECGQR
GGYFEMTNLSPQTVDEIYKVASVSLSPNVPGQIFLGLMVNPPKPGDISYLKYSAESKAVL
DSLRRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKAPDVFYCLKL
LEATGISTVPGSGFGQKDGVFHLRTTILPAEQDMPAIMASFKKFNDEFMEQYENYRGFSR
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctaagccattggattatgaatctctgaacgagaatgtgaagaaggtggcgtat
gcggtcaggggcgagctttatctgcgggcttccgagctgcagaaggaagggaaaaagata
attttcacaaatgttggcaatcctcatgctttagggcagaaaccattgacatttcctcgc
caggtggtagcactctgtcaagctccatttcttcttgaagatccaaatgtggcactacta
tttccagctgatgccattgcaagagccaaacattacctttcaatgacttccggcggcctt
ggtgcatatagtgattctcgaggtcttcctggtataaggaatgaaattgctgagttcatt
aagagacgtgatggataccctagcgatccagaacttatatttctcacagatggtgccagc
aaaggtgttatgcagatgctaaattctattatcagaaatgatagagatgggattttggtg
ccagttccacaataccctctttattcagctacaatatccttatatggtggctcccttgtg
ccatattatttagaggaagaagaaaactggggtcttgacttggacaatgttaaaaagtca
gtagcaacggcacgcgctaatgggataactattcgagctatggtgatcataaacccagga
aaccctactggacaatgtctcagtgaagccaatttaaaggaaatattgttgttttgctat
cgagaaaacttagtcctgcttgcagatgaagtttatcaacaaaatatatatcaggacgag
cggcctttcataagtgctagaaagatattgttggatatgggccctcctatcagcaaggag
gtgcaacttgtttccttccacactgtttcaaaaggatactggggcgaatgcggacagcgt
ggaggatactttgagatgactaatctttctccgcagaccgttgatgaaatttataaagtt
gcttcagtttcactgagccccaatgtccctggtcagatttttctagggttgatggtgaat
cctccaaagccaggtgatatctcctacttgaaatactctgcagagagcaaagcagtccta
gattcccttaggagaagagctcatataatgactgatggatttaatagctgcaaaaatgta
gtttgtaattttacagaaggtgctatgtattcatttccacaaattcgcttaccaccaaag
gcaattgaagctgcaaaaaaggctggaaaggctcctgatgttttctattgccttaagctc
ttggaagctactggtatttctacagttccaggctcaggatttggccagaaggatggcgtt
tttcatctaaggacaaccatactaccagctgagcaagatatgcctgctataatggccagc
ttcaaaaaattcaatgacgagttcatggagcaatatgagaattacagaggattttccagg
atatga

DBGET integrated database retrieval system