KEGG   Dendrobium catenatum: 110111573Help
Entry
110111573         CDS       T05027                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dct  Dendrobium catenatum
Pathway
dct00250  Alanine, aspartate and glutamate metabolism
dct00410  beta-Alanine metabolism
dct00430  Taurine and hypotaurine metabolism
dct00650  Butanoate metabolism
dct01100  Metabolic pathways
dct01110  Biosynthesis of secondary metabolites
Module
dct_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110111573
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110111573
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110111573
   00430 Taurine and hypotaurine metabolism
    110111573
Enzymes [BR:dct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110111573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110111573
NCBI-ProteinID: XP_020699154
LinkDB All DBs
Position
Unknown
AA seq 509 aa AA seqDB search
MVLSRAQSESSDSSVHSTFASRYVRTSLPRFRMLDESIPKEAAYQIINDELMLDGNPRLN
LASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNIIAHLFNAPLADSEAAI
GVGTVGSSEAIMLAGLAFKRRWQNKMRAQGKPCDKPNIVTGANVQVCWEKFARYFEVELK
EVKLRDGYYVMDPEKAVELVDENTICVAAILGSTLNGEFEDVKLLNDLLIKKNKETGWDT
PIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEE
LIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNIMENCQENATVLKTGLE
STGRFTIVSKDRGVPLVAFSLKDRSRHDEFEVSDYLRRFGWIVPAYTMPPDAQHVTVLRV
VIREDFSRTLAERLVFDIQKVLQELDALPSKFLVVAAGDNGAAEKAVKAVKAGDSDSVIL
VKKAEVETQRKVAEAWRKFVIAHKTNGVC
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggttctctctcgcgcccaatcggagtcgtcggactcctcagtccactccaccttcgcc
tcccgctacgtccgcacctctcttcccagatttcggatgctggatgaatcgataccgaag
gaggcggcttaccagatcattaatgatgagttgatgcttgatgggaaccctagattgaac
ttggcgtcgttcgtgacgacgtggatggagccggagtgcgacaagctcatcatggcctct
attaacaagaactatgtcgacatggatgagtatccagtcaccactgagctccagaatcga
tgtgtcaacatcatcgctcacctcttcaacgcccccctcgctgactccgaggctgcgatc
ggcgtcgggactgtcggctcatcggaagccataatgctcgccggactcgccttcaagagg
cggtggcaaaacaagatgagagctcaagggaagccatgtgacaagccaaatatcgtcaca
ggtgccaatgttcaggtatgctgggagaaatttgccagatattttgaggttgaactgaag
gaagtgaagctgagagatggatactatgtgatggatcctgagaaggccgttgaattagtg
gacgagaatacaatatgtgttgctgccattttgggctctactctcaacggagagtttgaa
gatgttaagctcctgaacgatctcctcataaagaagaacaaggagactggatgggataca
ccaatacatgtggacgcggccagtggggggtttatagcgccgttcctgtacccggagctg
gagtgggacttcaggcttcctcttgttaagagtattaacgtgagcgggcataaatatgga
ctcgtctacgctggcatcggctgggttatttggaggagcaaggaagaccttccagaagaa
cttatcttccacatcaactatctgggcgctgatcagcccacgttcactctcaatttctcc
aaaggatcaagccaggtcattgcacaatactatcaactaattcgcctgggattcgagggg
tacaggaacataatggagaactgccaggaaaacgccaccgttctgaaaaccggcctagaa
agtaccggccggttcaccatcgtctccaaggaccggggtgtcccgctcgttgccttctcc
ctcaaagaccggagccgacacgacgagttcgaggtctccgactacctccgccggttcggt
tggatcgtgccggcctacacgatgccgcccgatgcccagcacgtgacggttctccgcgtc
gtcatccgcgaagatttcagccgcacgcttgccgagcgcctcgtcttcgatatccagaag
gttctgcaagagctcgacgctctgccgtccaagttcctcgtggtcgcagccggcgataat
ggggctgcggagaaggcggttaaggcggttaaagccggagatagtgacagcgtgattttg
gtgaagaaggcggaggtagagacgcagaggaaggttgctgaagcttggaggaagtttgtt
attgcgcataagaccaatggggtttgctga

DBGET integrated database retrieval system