KEGG   Dendrobium catenatum: 110112368Help
Entry
110112368         CDS       T05027                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dct  Dendrobium catenatum
Pathway
dct00010  Glycolysis / Gluconeogenesis
dct00020  Citrate cycle (TCA cycle)
dct00620  Pyruvate metabolism
dct01100  Metabolic pathways
dct01110  Biosynthesis of secondary metabolites
dct01200  Carbon metabolism
Module
dct_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110112368
   00020 Citrate cycle (TCA cycle)
    110112368
   00620 Pyruvate metabolism
    110112368
Enzymes [BR:dct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     110112368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 110112368
NCBI-ProteinID: XP_020700224
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MALPFATSSSATAAPGNPLLSFSSSISPSIPALPSRCLLPRRSHSRTATVRAKIREIFMP
ALSSTMTEGKIVSWIKSEGDRLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGEVAP
VGAPIGLLAETEDEVALAKAKAQSPAQSRTAAVSASPPSPVAAAPVASPLTVPAEGSRKL
VATPYAKKLAKQHKVDIGSVTGTGPFGRVTPQDVELAAGIQPKKPSPTPVAAPPSVSKGA
AVTPVAEKAAAPAALPPIPGSTVVPFTTMQAAVSKNMLESLSVPTFRVGYPVIANALDAL
YEKVKSKGVTMTVLLAKAAAMALAQHPVVNASCKDGKSFSYNSNINIAVAVAIDGGLITP
VLQDADKLDIYLLSQKWKELVSKARSKQLQPKEYNSGTFTLSNLGMFGVDRFDAILPPGQ
GAIMAVGASKPTVVAGADGFFTVKNKMLVNVTADHRIIYGADLAAFLQTFSKIIENSDNL
TL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttccctttgccacatcctcctccgccaccgctgctcccggcaatcccctgctt
tccttctcgtcttcaatttcaccctccattcccgctcttcccagccgctgcctcctcccg
cgccgttcccactctcggaccgcaactgtgcgcgccaagatccgcgagatctttatgccg
gcgctgagctccacaatgaccgaaggcaagatcgtgtcctggatcaagtccgagggcgac
cgcctttccaagggcgagagcgtcgtagtcgtcgagtcggacaaggccgatatggacgtc
gagaccttctacgatggcatcctagccgccatcgtcgtccctgagggcgaggtcgccccc
gtcggcgccccgatcggtctcctcgccgagaccgaggacgaggttgccctagccaaagcc
aaggcgcagtctccagcgcaatcacggacggctgctgtatctgcttctccgccgtctccg
gtcgcagcagctcccgttgcttcacccttgaccgtgccagccgagggatcgaggaaattg
gtggctacaccctacgctaaaaaactcgcgaagcagcacaaggtggatattggctctgtg
acagggaccgggccctttgggagagttactcctcaggatgtggagctagctgctgggatc
caacctaagaaaccttctccgactcctgtcgcagctcctccttccgtatcgaaaggtgcc
gctgttactcccgttgcagaaaaagctgctgcgcctgctgcattacctccaatcccgggc
tctacagtggtgccatttacgacaatgcaggcagcagtgtcgaagaacatgttggaaagt
ctatcggtgcccacatttcgggttgggtatccagtgatcgcaaatgctcttgatgcactg
tatgaaaaggtcaagtcaaaaggtgtgactatgactgtcctattggcaaaggctgcagca
atggcacttgcacagcatccggttgttaatgctagctgcaaggatgggaagagcttcagt
tataatagcaacatcaatattgcagtggctgtggcaattgatggtgggcttataactcct
gttctccaagatgctgataagctggatatctatctcctttctcaaaaatggaaggaactt
gtgagcaaagctcgatctaagcagctccagcccaaagagtataattcaggaacatttacc
ctgtctaaccttggcatgtttggagttgatagatttgatgctattcttcctccgggtcag
ggggcaattatggctgtgggagcatccaaaccaacagttgtggctggtgctgatggtttc
tttactgtaaagaacaaaatgctggtgaatgtaacagcagatcaccggattatttatggt
gcagacttggctgctttccttcaaacattttcgaagataatagaaaattctgataacttg
actctgtaa

DBGET integrated database retrieval system