KEGG   Dendrobium catenatum: 110113091Help
Entry
110113091         CDS       T05027                                 

Definition
(RefSeq) glutathione S-transferase U25-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dct  Dendrobium catenatum
Pathway
dct00480  Glutathione metabolism
dct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110113091
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dct02000]
    110113091
Enzymes [BR:dct01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110113091
Transporters [BR:dct02000]
 Other Transporters
  Pores ion channels [TC:1]
   110113091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_2 GST_N_2 GST_C_3 GST_C_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 110113091
NCBI-ProteinID: XP_020701178
LinkDB All DBs
Position
Unknown
AA seq 220 aa AA seqDB search
MSRSNVVLLDHWVSPYAMRVRIALWEKGVEFESRQQDLGNKSELLLRSNPIYKKAPVLLH
DDKPLCESLIIVEYIDEVWPSPPLLPSSSYERATARFWADFIDKKFAEAAIKTWRSARSA
EELEAARNEFFETLKQLEEFLGEKDYFGGETFGLVDLALIPFWSWFSAYEKFGGFKIESP
KLSAWIQRCMERESVAKALPAQEKVLEFVCMLRKIFGFDQ
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggtctaatgtagttctcttggatcattgggttagcccatatgccatgcgggtc
aggattgcactatgggagaaaggagttgagttcgagtcaaggcaacaagacttgggcaat
aagagtgagttgctacttcgatcaaatcctatctacaagaaggctcctgttcttttgcat
gatgataaaccgttgtgtgagtctcttattatagttgagtatattgacgaggtatggccg
agtcctccattgttaccttcaagctcttatgaacgtgctaccgcccgattttgggccgat
ttcatagataaaaagtttgcagaagctgcaatcaagacatggagaagcgcaaggtcggcc
gaggagcttgaagcagcgaggaacgaattcttcgagacactgaagcagctggaagaattt
ctgggagaaaaagattactttggtggagaaacttttgggctcgtagacttggcgctgatt
ccattttggagctggttctctgcttatgagaagtttgggggattcaagatagaaagccca
aagctctctgcttggatacaaaggtgcatggagagagaaagcgtcgccaaagcgctgccg
gcgcaggagaaggtgttggagtttgtctgcatgttgaggaaaatttttggattcgatcag
taa

DBGET integrated database retrieval system