KEGG   Dendrobium officinale: 110113261Help
Entry
110113261         CDS       T05027                                 

Definition
(RefSeq) histone deacetylase 5
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
dct  Dendrobium officinale
Brite
KEGG Orthology (KO) [BR:dct00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dct01009]
    110113261
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dct03019]
    110113261
   04131 Membrane trafficking [BR:dct04131]
    110113261
   03036 Chromosome and associated proteins [BR:dct03036]
    110113261
Enzymes [BR:dct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110113261
Protein phosphatases and associated proteins [BR:dct01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110113261
Messenger RNA biogenesis [BR:dct03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     110113261
Membrane trafficking [BR:dct04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    110113261
Chromosome and associated proteins [BR:dct03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     110113261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110113261
NCBI-ProteinID: XP_020701418
LinkDB All DBs
Position
Unknown
AA seq 685 aa AA seqDB search
MNSSPEDRRSARVGLAYDERMCLHATPDGESHPENPERIRAIWRKLEAEGIPDRCILLKI
KEAEDAIIASVHTRNHIKLIRNISSKKFDSRRLMIASKLNSIYFNEGSSKAAYLAAGTVI
EATENVANGNLDSAIAVVRPPGHHAEANEAMGFCLFNNVAIAASYLLNERAELSMRRILI
VDWDVHHGNGTQNMFYSDPRVLYFSVHRFDFGSFYPAGSDGSHCMIGEDQGVGYNINVPW
EHGQCGDADYLAVWDHILIPVAEAYNPDIILISAGFDAAMGDPLGGCCVTPYGYSVMLKR
LMKFADGKIVLALEGGYNLNSLANSVFACAKTLLEGSPIVGNFEGRPFESTWRVINEVRN
ELKTYWPVFSIDLPEEILIANVERYPIQAGINSSSDSDVEKDLEPSNAINFSSNNDVGDL
ILPLSKLNVDDGDSGELSHLRSQQNQPGTSEAYENSKEVTTETCNDLFHWRSSLSKVDVW
YGSYGSNMWKPRFLCYIEGGKVEGMTKPCRGALDKTPPKDIIWKSVPHRLFFARSYSNTW
GHGGVAFLNPQSNINDKSYMCIYRITLEQFNDLLIQENAATEQFESPLVDSRDIEFLVKN
SFMSVESIKGGWYSNILYLGEQDGIPILTMTCSLSDVEKFKSGELPVCAPPKAYENTLLK
GLLEGTELSSEEAIGYVKDAVARNL
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgtcgcctgaggatcgccggagtgctcgggtgggattagcttacgacgagaga
atgtgtctgcacgccacacccgatggggagagccatccggaaaaccccgagcggattagg
gccatatggaggaagctggaggcggaaggcattcctgacaggtgcatattgcttaaaatc
aaggaagctgaggatgcaattatagcatctgtgcatacgaggaatcacataaagctgata
agaaatattagctctaagaagttcgattctcgacgtctgatgattgcttcgaagttgaat
tctatttattttaacgagggttcttctaaggcagcctatcttgctgcaggaaccgttatt
gaggctacagagaatgttgcgaatgggaatctggattctgccattgctgttgttaggcct
cctggtcatcatgcagaagctaatgaagctatgggtttttgcctcttcaacaatgtggca
attgcagcatcctatctcttgaatgagagagcagaattaagtatgagaaggatattgatt
gtggactgggatgttcatcatggcaatggtactcaaaatatgttctatagtgatcctcgg
gtactttatttctcagtacataggtttgattttggaagtttctatccagctggcagtgat
ggttctcactgtatgattggagaagatcagggtgtagggtacaacataaatgtaccttgg
gaacacggtcaatgtggcgatgcagactatcttgctgtttgggaccatattttgattcct
gtagccgaggcatacaatccagacataatcttaatctctgctggatttgatgcagctatg
ggtgatccacttggtgggtgctgtgtcactccatatggttattcagttatgctcaaaagg
ctgatgaaatttgctgatggaaagattgtcttggcccttgaaggaggttacaatctcaac
tctctagctaattcagtttttgcttgtgcaaaaactttactagaagggagtcctattgtt
ggaaattttgagggcaggccttttgaatccacatggcgtgtaatcaatgaggttcgtaat
gaactgaagacttactggccagtattctctattgatctgcctgaagagattctaattgcc
aatgtcgaacgttacccaattcaggcagggatcaactctagctctgattctgatgtggaa
aaggacctagaaccttccaacgctataaacttctcctccaacaatgatgttggggatttg
atattacctctttcaaaattaaacgttgatgacggagattctggagaattgtcccattta
agatctcagcaaaaccaaccgggcacatcggaagcatacgaaaactcaaaggaggtaaca
actgagacatgcaatgatttgtttcattggagatcatctttgtcaaaggttgacgtttgg
tatggctcctatggctcaaatatgtggaaaccaaggtttctctgctacattgaaggtgga
aaggtggaaggtatgacaaagccatgtcggggagctctggacaaaactccaccaaaagat
atcatttggaagtctgtacctcatcggttattctttgcaagatcttattccaacacatgg
ggccatggaggtgttgcttttcttaatcctcaaagcaatataaatgataaaagttatatg
tgcatttatagaataacccttgagcagttcaatgatttactgatccaagagaatgccgcc
actgaacagtttgaatcacctttggtggattctcgtgatatagagtttctagtaaaaaac
agtttcatgtctgtggaatctatcaagggtggatggtactccaatatcctttatttggga
gagcaggatggcattccaattttaaccatgacgtgttcactatcagatgttgagaaattt
aaatctggtgagctaccggtttgtgctccaccaaaagcctatgagaatactctgttgaaa
ggattattagaaggtacagaactctcgtctgaggaagccatcggttatgttaaggacgct
gttgctagaaatttgtga

DBGET integrated database retrieval system