KEGG   Dendrobium catenatum: 110113338Help
Entry
110113338         CDS       T05027                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZ1 isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
dct  Dendrobium catenatum
Pathway
dct00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110113338
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dct03036]
    110113338
Enzymes [BR:dct01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110113338
Chromosome and associated proteins [BR:dct03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110113338
   Polycomb group proteins
    PRC2-EZH2 complex
     110113338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 110113338
NCBI-ProteinID: XP_020701546
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MASKVSSAVSAGKSEPPAAVQIDGVKEGVPTTRDILSVIDSLKKQVVSDRCILIKKRIEE
NKQKLSGITQHIYNMSKFRRNNTAESSDAGVDLLTRRQNDALCMLNNLDISCTDKDSSGY
QEESSHTPSAILFGQNFGGKNSIRPIKLAEMPKLPPYTTWIFLDRNQRMAEDQSVVGRRR
IYYDQSCGEALICSDSEEDIVDEEDDKKAFVNIEDYILRLTIQEVGLSDLVLDSLSQCLD
KGPSEIKARYENISVSERSNNCGRTVPKDDKIEDSFLEKDLDAALDSFDNLFCRRCLVFD
CRLHGCSQDLVFPSEKQLPWSCSDDGSPCGIHCYRLASKSESNATVNSQMPRVPEELSNS
NGSAGTHLSPRKKSCSSSIGRRVRSNQSESASLTARAVSESSESEVRHCQEHLTVNHSSP
PKTNLGVKSGKKNNKRVAERVLGSLRKKQKQVVPSDSDSVVKGSIAKQDMKLRSKICYGK
KGSASSLPSKVSKKAVKKSKKKKLVLHDGFDSTCPEVPNETHTGMIKETPATDGDEVSRK
EFVGENIYKGDSCYKSWRTFEKGLVSKGIEIFGRNSCLIARNLLSGLKTCMEIYHYLNFI
ENKAMYCASDGSHSLVEGHAKGMDVRARSRFVRRRGRVRRLKYTWKSAGYHSIRKRISER
KDQPCRQYNPCGCQSACGKQCPCILNGTCCEKYCGCPKICKNRFRGCHCAKSQCRSRQCP
CFAADRECDPDVCRNCWVGCGDGSFGGPVQLGDNYECRNMKLLLKQQQRVLLGGSDISGW
GAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKL
KFANHSPEPNCYAKVIMVAGDHRVGIFAKERIGAGEELFYDYRYEPDRAPAWARKPEASG
SKKEEAGPSTGRAKKLA
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaggtctcttccgcagtctccgccggcaaatcggagcccccagctgctgtc
cagattgatggagtgaaggaaggggtgcctactactcgtgacattctttctgttattgat
tccttgaagaaacaagttgtttctgatcgttgcatcctcatcaagaaaagaattgaagag
aacaaacagaaactaagtggcattacacagcatatctacaatatgtcaaagttcaggaga
aacaatacagctgaaagtagtgatgctggtgtggatttgcttacaagaaggcaaaatgat
gcactttgcatgctaaataaccttgacatctcctgtacagataaagatagcagtggttac
caagaagaaagttcccatacaccatcagctattctttttggtcaaaactttggtggaaag
aattcaatccgtcctatcaaactagctgaaatgccaaagctacctccatacactacatgg
attttcttggacagaaatcagagaatggcagaggatcaatccgttgttggccgtagaaga
atatattatgatcaaagctgtggtgaagctttaatttgcagtgatagtgaagaagatata
gttgatgaggaagatgataagaaagcgtttgtaaatattgaagattatattcttaggctg
actatccaagaagtaggcctctctgatcttgtgcttgattcattgtctcagtgccttgat
aagggtcctagtgaaatcaaggcaagatacgagaatatttctgtgtcagagagaagtaac
aattgtggtagaactgttccaaaagatgacaagattgaagattcatttttggaaaaagat
ctggatgctgctcttgattcctttgataaccttttctgcagaaggtgtctagtttttgat
tgtagattgcatggatgttctcaggatttagtatttccttcagaaaaacaacttccatgg
agctgctcagatgatggatctccatgtggcatccattgttataggctggcctccaaatca
gagagcaatgcaactgtgaattctcagatgcctcgtgtacctgaagaacttagtaattca
aatggaagtgctggaacacatctttcgccaagaaagaaatcttgtagttcctcaattgga
aggagagtaaggtccaatcaaagtgaaagtgcttcattaactgcaagggctgtatccgaa
agtagcgagtcagaagtgaggcattgccaggagcatttgaccgttaatcactcatcacct
ccaaagactaatcttggtgtaaaaagtgggaagaaaaataacaaaagagttgccgagcgt
gtgttaggttccttaaggaagaaacagaagcaagtggtaccatcagactcggattctgta
gttaagggatcaattgctaagcaagacatgaaacttcggtcaaaaatatgctatggtaaa
aagggatccgcttcatcattgccttccaaagtttcaaagaaagctgtaaaaaaatccaaa
aaaaagaaattggtactgcatgatggttttgattcaacttgtcctgaagttcccaatgaa
actcataccgggatgatcaaggagacaccagccactgatggtgatgaagtttcaagaaaa
gagtttgttggtgagaatatatacaaaggtgatagctgctacaagtcatggaggaccttt
gagaagggtcttgtctcaaaaggcatagaaatttttggtagaaacagctgtttaattgct
agaaatcttttaagtggactgaaaacttgcatggagatttaccactacttgaacttcatt
gaaaataaagcaatgtattgtgcttctgatggttctcattctctagttgaaggacatgcc
aagggcatggatgtacgagcaaggtcaaggttcgtcaggagacgaggtagagttcgtcgc
ttgaaatatacctggaagtctgctggttaccattccatcaggaaaaggatttcagagagg
aaagatcagccttgtcggcagtataacccttgtggttgtcaatctgcttgtggaaaacag
tgcccttgcattctgaatggaacttgctgtgaaaagtactgtgggtgtccaaagatttgc
aagaaccgttttagaggatgccattgtgctaagagtcaatgtcgcagtcgtcaatgtcct
tgctttgctgctgatagagaatgtgatccagatgtttgtagaaattgctgggttggatgt
ggtgatggcagttttggcgggcctgtacaactaggagacaattatgaatgcagaaatatg
aagcttctcctaaagcaacaacaaagggtactactaggtggatctgatatttctggttgg
ggtgctttcctaaagaatagcgttggtaagcatgaatatcttggagaatacaccggtgaa
ctgatctctcatagagaggcagataagcgggggaagatttacgatcgtgaaaactcatcc
tttcttttcaatctgaatgatcagtttgttctcgatgcttaccgcaagggtgataagttg
aagtttgccaatcattcccctgagccaaattgctatgctaaggtaatcatggtagctggt
gatcacagagtaggcatatttgccaaggaacgcattggtgctggggaagagctgttctat
gactaccgttatgagccagacagagctcccgcttgggcaaggaagcctgaagcttctgga
tcgaagaaggaggaagctggcccttcaactggccgtgctaagaaacttgcttaa

DBGET integrated database retrieval system