KEGG   Dendrobium officinale: 110114236Help
Entry
110114236         CDS       T05027                                 

Definition
(RefSeq) hexokinase-2, chloroplastic isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dct  Dendrobium officinale
Pathway
dct00010  Glycolysis / Gluconeogenesis
dct00051  Fructose and mannose metabolism
dct00052  Galactose metabolism
dct00500  Starch and sucrose metabolism
dct00520  Amino sugar and nucleotide sugar metabolism
dct01100  Metabolic pathways
dct01110  Biosynthesis of secondary metabolites
dct01200  Carbon metabolism
Module
dct_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dct_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110114236
   00051 Fructose and mannose metabolism
    110114236
   00052 Galactose metabolism
    110114236
   00500 Starch and sucrose metabolism
    110114236
   00520 Amino sugar and nucleotide sugar metabolism
    110114236
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110114236
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dct04131]
    110114236
Enzymes [BR:dct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110114236
Membrane trafficking [BR:dct04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110114236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110114236
NCBI-ProteinID: XP_020702699
LinkDB All DBs
Position
Unknown
AA seq 495 aa AA seqDB search
MSAAPATVGTFSIRTRCGRRPIPSFRCSLAGGVTTVPILTELKMKCATPLPLLQRIADAM
ASDMRAGLAADNGSDLKMILSYVDSLPTGNEKGLFYALDLGGTNFRVVRVQLGGKQNKVV
DSEFEQVSIPQELMQGTTEELFNFIASKLANFAAKESGKFQLPKGRTREIGFTFSFPIKQ
TSINSGILIKWTKGFAVLGTAGKDVVACLKEAMQRQGLDMSVSALVNDAVATLAGAKYWD
DDVLIAVILGTGTNACYIERKDAIPKLQWPAGGTRNMIISTEWGAFTTDLPLTEFDKDMD
SESINPGEQIFEKTISGMYLGEIVRRVLLKMASFSSLFGDSIPEKLLIPLVLRTPDLCAM
QQDDTKDLSKVEEILSNTIGETRSTLKARRIVVDVCDTIVKRGGRLAGAGIVGILQKMEQ
DSKGLISGKRTVVAMDGGLYEHYPQYRNYLKDAVAELLGAEVSKNIVIEHTKDGSGIGAA
LLAAANSKYASEFQI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgctccagctacggtgggaacattctccatccgcacgcgctgtgggaggcgg
ccgatcccatctttccggtgctccctggccggcggagtgacgacggtgccgatcttgacg
gaactaaagatgaagtgtgccacgccgcttcccttgctccaacgcatcgccgacgcaatg
gcatcggatatgagagcaggtttagcagccgataatggaagtgatctgaagatgatcctt
agctatgttgattcccttcccaccgggaatgagaagggtctattttatgcattggatctt
ggaggtactaattttcgggtggtgagggtgcagctaggaggtaagcaaaacaaagttgtt
gattctgagtttgagcaggtatcaattccacaggagctaatgcaaggaaccactgaggaa
ctgttcaactttattgcatctaaactagcaaattttgctgcgaaagaaagtgggaaattt
cagctgcccaagggaaggacgagggagataggttttacattttcttttccaataaaacaa
acttccattaattcaggcattctcatcaagtggacaaaaggatttgcagtcttggggacg
gcagggaaagatgtggttgcttgtttaaaagaagcaatgcagaggcagggtctagatatg
tcggtatctgccttggttaatgatgcggtggcaacattagctggggcgaaatactgggat
gatgatgtcctgattgctgtaatattaggtacaggtaccaatgcttgctacattgagcga
aaggatgccatccctaagctgcagtggccagcaggaggaaccagaaacatgattatcagc
actgaatggggagcattcactacggatcttccgttgactgaatttgacaaggatatggat
tctgaaagtataaatcctggagagcagatatttgagaagacaatatctgggatgtacctt
ggtgagatagtacgacgagtactcctaaagatggcgagtttttcatccctttttggtgat
tctattcctgaaaagctcttaattccgttagtactaaggactccggatctttgtgccatg
cagcaggatgacaccaaagatttaagtaaagtggaagaaatcttgagcaataccattggt
gaaacaaggtctacactgaaagctaggaggattgtagttgacgtttgtgacacaatcgtg
aagcggggcggaagattggctggggctggaattgtgggaattctgcagaagatggaacaa
gattcaaaggggctgatttctgggaagcgaactgtggtcgccatggatggaggactctat
gaacattatcctcagtatagaaactaccttaaagatgctgttgcagagttacttggtgct
gaagtctcgaagaatatagtcatcgagcataccaaagatggctctggaattggagcagct
ttattagcagcagcaaattcaaagtacgcttctgagttccaaatttga

DBGET integrated database retrieval system