KEGG   Dendrobium catenatum: 110114830Help
Entry
110114830         CDS       T05027                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
dct  Dendrobium catenatum
Pathway
dct00010  Glycolysis / Gluconeogenesis
dct00053  Ascorbate and aldarate metabolism
dct00071  Fatty acid degradation
dct00280  Valine, leucine and isoleucine degradation
dct00310  Lysine degradation
dct00330  Arginine and proline metabolism
dct00340  Histidine metabolism
dct00380  Tryptophan metabolism
dct00410  beta-Alanine metabolism
dct00561  Glycerolipid metabolism
dct00620  Pyruvate metabolism
dct00903  Limonene and pinene degradation
dct01100  Metabolic pathways
dct01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110114830
   00053 Ascorbate and aldarate metabolism
    110114830
   00620 Pyruvate metabolism
    110114830
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110114830
   00561 Glycerolipid metabolism
    110114830
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110114830
   00310 Lysine degradation
    110114830
   00330 Arginine and proline metabolism
    110114830
   00340 Histidine metabolism
    110114830
   00380 Tryptophan metabolism
    110114830
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110114830
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    110114830
Enzymes [BR:dct01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110114830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110114830
NCBI-ProteinID: XP_020703503
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MNMSAAARRIASSISCRSISSVLRSSSSFMLRGRIAGVSSGIQRLSTAAAALEEPITPPV
QVNYTKLLINGQFVDSASGKTFSTLDPRTGEVIAHVAEGDAEDVDRAVAAARKAFDEGPW
PKMSAYERSRILYRFADLIEKHNDEIAALETWDNGKPYEQAAFGEIPMVARLFRYYAGWA
DKIHGLIVPADTPHHVQVLHEPIGVVGQIIPWNFPLLMFAWKVGPALACGNSIVLKTAEQ
TPLSALVVAKLLHEAGLPDGVLNVVSGYGPTAGAAIASHVDVDKLAFTGSTSTGKIVQEM
AARSNLKPVTLELGGKSPMIIMDDADIDKAVELAHFALFFNQGQCCCAGSRTFVHERIYD
EFVEKAKARALKRVVGDPFKKGVEQGPQIDEEQFNKILHFIKSGVEGGATLVAGGERHGD
RGYFIKPTIFADVKDGMEIAKHEIFGPVQSILKFSDLKEVIKRSNASQYGLAAGVFTQNL
DTANTLMRALRVGTIWINSFDIFDAAIPFGGYKMSGYGREKGIDSLKNYLQIKSVVTHLK
DPAWL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgtcggctgcggcgcggaggattgcatcttctatttcctgtcgctctatttca
tctgttcttcgttcttcttcctcttttatgctccgagggaggattgctggtgtttcttct
gggatccaaaggcttagcactgcggctgctgctttggaagaacccataacacctcccgtg
caagtgaactacaccaaacttctcatcaatggccaatttgttgattcggcatcaggaaag
accttctcaaccttagatcccagaactggagaagttatagctcatgtggctgaaggagat
gctgaagatgttgacagagctgtcgcggctgctcgtaaggcatttgacgaaggcccatgg
ccgaagatgtcagcttatgaaaggtctcgcatattatatcgatttgctgatttgattgag
aagcacaatgatgagattgctgcacttgagacttgggacaatgggaagccttatgagcaa
gctgcctttggtgagatcccaatggttgcacgtttgtttagatattatgcaggctgggca
gataaaatacatggactgattgttcctgctgatacgccacatcatgtgcaagtattgcat
gagccaattggtgttgtaggccaaataattccatggaattttccccttctcatgtttgcc
tggaaggttgggccagcacttgcatgtgggaattcaattgtgctaaagactgcagagcag
actccattatctgctttagtagtagctaagttactacatgaggctggtctccctgatggc
gtgcttaatgtagtctctggatatggtccaactgctggtgctgctattgctagtcacgtg
gatgttgataagcttgcctttactggctcaacctctactggaaagattgttcaggaaatg
gctgccagaagcaaccttaaaccagtgactctagagcttggaggtaaatctcccatgata
attatggatgatgccgatattgacaaagcagttgagctcgcccatttcgctttgttcttc
aatcagggacaatgttgctgtgctggctcacggacatttgttcatgagcgcatatatgat
gagtttgtcgaaaaagccaaggctagagctctaaagcgtgttgtaggtgacccattcaag
aagggtgtggagcaaggtcctcagattgatgaggagcaattcaacaagatcttgcacttc
ataaagtctggggttgaaggcggggctacacttgttgctggaggcgagagacatggcgac
cgaggatactttattaaacctaccatttttgcagatgtcaaggatggaatggagatagca
aaacatgagatcttcggaccggttcaatcgatattgaagttctcggaccttaaggaggtc
attaaaaggtcaaatgccagccaatatggattggctgcaggagttttcacccagaacttg
gacactgctaataccttaatgagagctttgagagttgggacgatatggatcaacagcttc
gatattttcgacgcagcgattcccttcggaggctataagatgagcggctacggccgcgaa
aaaggcatagatagcctgaagaactacctgcagattaaatcagttgttactcacctgaag
gaccctgcatggttgtaa

DBGET integrated database retrieval system