KEGG   Dendrobium officinale: 19046868Help
Entry
19046868          CDS       T05027                                 

Gene name
rbcL, DEOF_Cp027
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
dct  Dendrobium officinale
Pathway
dct00630  Glyoxylate and dicarboxylate metabolism
dct00710  Carbon fixation in photosynthetic organisms
dct01100  Metabolic pathways
dct01200  Carbon metabolism
Module
dct_M00165  Reductive pentose phosphate cycle (Calvin cycle)
dct_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
dct_M00532  Photorespiration
dct_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:dct00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    19046868 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    19046868 (rbcL)
Enzymes [BR:dct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     19046868 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 19046868
NCBI-ProteinID: YP_009026445
UniProt: X2CAX3
LinkDB All DBs
Position
CP
AA seq 490 aa AA seqDB search
MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEA
GAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEVVVGEENQYIAYVAYPLDLFEEGSV
TNMFTSIVGNVFGFKALRALRLEDLRIPTSYSKTFQGPPHGIQVERDKLNKYGRPLLGCT
IKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIFKAQAETG
EIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHI
HRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREMTLGFVDLLRDDF
IEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGN
APGAVANRVSLEACVQARNEGRDLAREGNDIIREAAKWSPELAAACEVWKEITFEFEPVD
KVDKLDKETK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtagggagggacttatgtcaccacaaacagagactaaagcaagcgttggattt
aaagctggtgttaaagattacaaattgacttattatactcctgactacgaaaccaaagat
actgatatcttggcagcattccgagtaactcctcaaccgggagttccgcctgaagaagcg
ggggctgcggtagctgccgaatcttctactggtacatggacaactgtgtggactgatgga
cttaccagtcttgatcgttacaaaggacgatgctaccacatcgaggtcgttgttggggag
gaaaatcaatatattgcttatgtagcttatcctttagacctttttgaagaaggttctgtt
actaacatgtttacttccattgtgggtaatgtatttggtttcaaagccctgcgagctcta
cgtctggaagatctgcgaattcctacttcttattccaaaactttccaaggtccgcctcat
ggcatccaagttgaaagagataaattgaacaagtatggtcgtcccctattgggatgtact
attaaaccaaaattgggattatccgcaaaaaactacggtagagcggtttatgaatgtcta
cggggtggacttgattttactaaggatgatgaaaacgtaaattcacaaccatttatgcgt
tggagagatcgtttcttattttgtgccgaagcaatctttaaagcgcaagccgaaacgggt
gaaattaaaggacattacttgaatgcaactgcgggtacatgtgaagaaatgatcaaaaga
gcggtatttgccagagaattgggagttcctatcgtaatgcatgactacttaactgggggg
ttcaccgcaaatactagcctggctcattattgccgcgacaatggtctacttcttcacatc
catcgcgcaatgcatgcagttattgatagacagaaaaatcatggtatgcattttcgtgta
ctagctaaagcattacgtatgtctggcggagatcatattcacgctggtacagtagtgggt
aaactggaaggggaacgtgagatgactttgggttttgttgatttgttacgtgatgatttt
attgaaaaagatcgaagtcgtggtatttttttcactcaagactgggtctctatgccaggt
gttctgcccgtggcttcagggggtattcatgtttggcatatgcctgccctaaccgaaatc
tttggggatgattccgtactacagtttggtggaggaactttagggcacccttggggaaat
gcacccggtgcagtagctaatcgggtgtctttagaagcatgtgtacaagctcgtaatgag
ggacgtgatcttgctcgtgaaggtaatgatattattcgtgaagctgccaaatggagtcct
gagctagccgctgcttgtgaagtatggaaagagatcacattcgagttcgaaccagtggat
aaggtggataagctagataaagagacaaaataa

DBGET integrated database retrieval system