KEGG   Dickeya paradisiaca: Dd703_1974Help
Entry
Dd703_1974        CDS       T00927                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dda  Dickeya paradisiaca
Pathway
dda00010  Glycolysis / Gluconeogenesis
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd703_1974
Enzymes [BR:dda01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Dd703_1974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACS85764
UniProt: C6C5X3
LinkDB All DBs
Position
2344802..2345674
Genome map
AA seq 290 aa AA seqDB search
MNDSIYSLPIIDTITAHISQRQLDQLPLIVVEHPKVRAAVALQGAHLLSWQPQGEAPVLW
ISENTPFEDGVAIRGGVPICFPWFGPVSQPNHGFGRLLPWEFTAHSEDEHGVTLSFTLRD
TEQTRQAWPHEFTVIARFHLSQSECHMELEAHGNYSITSALHTYFQIGDIGKISVSGLGD
TFIDKVNGGNTDVQQGDLVFTDRTDRIYTHPSSISRIQDPVLNRTIEVHHHHHSDVVAWN
PGADLAKTISDMTEAGSRTFVCVETAKVTQPFVATTQAPARLATTIRINK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacagcatctattcgcttcctatcatcgacactattaccgctcatatcagtcaa
cgtcagttagatcagctaccgctgatcgtcgtcgaacacccgaaagttcgtgctgccgtc
gccctacagggggcgcacctgcttagctggcaaccccagggcgaagcgccggtactgtgg
atcagcgagaatacgccatttgaagatggcgtagctattcgcggcggcgtccccatttgt
ttcccttggtttggcccggtatcccagcccaaccacggtttcggccgactgttgccgtgg
gagttcaccgcacacagcgaggatgagcacggcgttaccctctccttcacattgcgtgat
accgagcaaacccggcaagcttggccgcatgaattcaccgtgatagcgcgtttccacttg
agccagtccgaatgtcatatggagttggaagcacacggcaattacagcattaccagcgcg
ctgcatacctatttccagattggtgacatcggcaaaatcagtgtcagtgggctgggagat
acgttcatcgacaaagtgaatggcggtaatactgatgtccaacagggtgatttggtcttt
acggatcggacggatcgtatttatacacacccctcgtccattagccgcattcaggatccg
gtactaaaccgcaccattgaagtgcatcaccaccaccatagcgatgtcgttgcctggaac
ccaggtgctgatctggcgaaaaccatcagcgatatgaccgaagcgggcagccgaaccttc
gtttgcgtggaaaccgccaaagttactcagccgtttgtcgccacgacccaggccccggcc
cgtctggccactacgatccgtatcaataagtga

DBGET integrated database retrieval system