KEGG   Dickeya paradisiaca: Dd703_3738Help
Entry
Dd703_3738        CDS       T00927                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
dda  Dickeya paradisiaca
Brite
KEGG Orthology (KO) [BR:dda00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dda03012]
    Dd703_3738
   03029 Mitochondrial biogenesis [BR:dda03029]
    Dd703_3738
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dda04147]
    Dd703_3738
Translation factors [BR:dda03012]
 Eukaryotic Type
  Elongation factors
   Dd703_3738
 Prokaryotic Type
   Dd703_3738
Mitochondrial biogenesis [BR:dda03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dd703_3738
Exosome [BR:dda04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dd703_3738
  Exosomal proteins of breast cancer cells
   Dd703_3738
  Exosomal proteins of colorectal cancer cells
   Dd703_3738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ACS87493
UniProt: C6C4T6
LinkDB All DBs
Position
complement(4332021..4333205)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGQARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GDAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgccatcaccaccgttttggctaaaacctac
ggtggtcaggctcgcgcattcgaccagatcgacaacgcgccggaagaaaaagcgcgtggt
atcaccatcaacacctctcacgttgaatacgataccccgactcgtcactacgcacacgtt
gactgcccagggcacgccgactacgtgaaaaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtggtggctgcaactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgccaggtaggtgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagtgcgcgagctgctgtctcag
tacgacttcccgggcgacgacacgccggtaatccgcggttccgcgctgaaagcgctggaa
ggcgatgccgagtgggaagcgaaaatcatcgaactggccgaagccctggacagctacatt
ccggaaccggaacgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggccgtggtaccgttgtgaccggtcgtgtagagcgcggcatcatcaaagtgggt
gaagaagttgaaatcgtgggtatcaaagaaaccacgaaaaccacctgtaccggtgttgaa
atgttccgcaaactgctggacgaagggcgtgcgggcgagaacgtaggtgttctgctgcgt
ggtaccaaacgtgatgaagttgaacgtggtcaggtactggctaaaccgggctcaatcaag
ccgcacactcagttcgaatctgaagtgtatattctgagcaaagatgaaggtggccgtcat
acgccgttctttaaaggctaccgtccgcagttctacttccgtaccactgacgtgacaggc
accatcgaactgccggaaggcgtggaaatggtgatgccgggcgacaacatcaagatggtc
gtaaaccttatcgcgccgatcgcgatggacgacggtctgcgtttcgctatccgtgaaggc
ggccgtacagtaggcgctggcgtggttgctaaagttatcgcttaa

DBGET integrated database retrieval system