KEGG   Dickeya paradisiaca: Dd703_3747Help
Entry
Dd703_3747        CDS       T00927                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
dda  Dickeya paradisiaca
Pathway
dda00071  Fatty acid degradation
dda00280  Valine, leucine and isoleucine degradation
dda00281  Geraniol degradation
dda00310  Lysine degradation
dda00362  Benzoate degradation
dda00380  Tryptophan metabolism
dda00410  beta-Alanine metabolism
dda00640  Propanoate metabolism
dda00650  Butanoate metabolism
dda00903  Limonene and pinene degradation
dda00930  Caprolactam degradation
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
dda01200  Carbon metabolism
dda01212  Fatty acid metabolism
Module
dda_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Dd703_3747
   00650 Butanoate metabolism
    Dd703_3747
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dd703_3747
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dd703_3747
   00310 Lysine degradation
    Dd703_3747
   00380 Tryptophan metabolism
    Dd703_3747
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dd703_3747
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dd703_3747
   00281 Geraniol degradation
    Dd703_3747
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dd703_3747
   00930 Caprolactam degradation
    Dd703_3747
Enzymes [BR:dda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Dd703_3747
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dd703_3747
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Dd703_3747
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Dd703_3747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACS87501
UniProt: C6C4U4
LinkDB All DBs
Position
4347431..4349623
Genome map
AA seq 730 aa AA seqDB search
MLYQGNNLSLNWLENGIAELVFKAESGSVNKLDTRTVASLGDALNVLVRQNALRALLLRS
DKPAFIVGADITEFLSLFAAPEQQLHQWLTHANSIFSQLEDLPIPTLSAINSFALGGGCE
CALATDFRIATPDVRIGLPEVRLGIMPGFGGTVRLPRLLGVDNALEIITAGKELNAAEAL
KVGLVDAIVTDDKLISAALQTLRLAIEGKLDWQARRRPKLQPLRIGRVEAAMSFATARAL
VAQLAGKHYPAPMTAVKTIEAAASLARHDALRLETDNFVALTQSSAAHALVGVFLNEQAI
KSKAKAQATDTSPPEKVAVLGAGIMGGGIAYQSALQGVPVWMKDISDKALNLGMTEAATL
LGKQLERGKLDAAALSGVMARIHPTLTNEGVEQAALIVEAVVENPRIKAQVLAEAEALIG
DDTVLASNTSTIPIATLAAALKRPQRFCGMHFFNPVHRMPLVEVIRGPQTDERTLSRVVA
YAIRMGKTPIVVNDCPGFFVNRVLFPYISAFCLLLRDGADFQFVDAVMEQQFGWPMGPAY
LLDVVGLDTAHHARQVMAAGYPDRMRQDYRDVIDVLTEHQRFGQKTGAGFYRYQTDNKGK
ARKETDSGTETLLAPVCQPSRTFSPEEIVSRMMIPMLNEVARCLEEGIVASPAEADMALV
YGLGFPAFRGGACRYLDTQGISSYLAMAQRFVALGPLYRIPDSLPDMAERRSRYYAPVTP
HAGLAPHSPD
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgctctatcaaggcaataatctctctctgaactggctggaaaacggtatcgccgagctg
gtgttcaaggcggaatcaggctccgtcaataagctggacactcgcacggtagccagtctc
ggcgacgcgctgaacgtgttggttcgccagaatgcgttgcgggcgctgctgctgcgctcc
gacaaacccgcgtttatcgtcggcgccgatatcaccgaatttctgtcgctattcgcagcc
cccgaacaacagttgcaccaatggttaacgcacgccaactctattttcagtcaattggaa
gatctgccgattcccacgctgtccgccatcaacagctttgcgctgggcggcggttgtgaa
tgcgcgctggcgacggactttcgcatcgccacacccgatgtacgtatcgggctgccggaa
gtccggctcgggatcatgcccggctttggcggtaccgtgcggctgccgcggctactgggg
gtagacaatgcgctggaaatcatcaccgccggcaaggagctgaacgcggcggaggcgctg
aaagtcggcctggtcgacgcgatagtgacagacgacaaactgatctccgccgcgctgcaa
acactgcggctggcgattgaaggcaagctcgactggcaggcgcggcgccgcccgaaactg
caaccgttgcggattggccgcgtcgaggccgccatgagtttcgctaccgccagagcgctg
gtcgcgcaacttgccggcaagcactaccccgcgccgatgacggcggtcaaaaccatcgaa
gccgccgccagtctggcgcgccatgacgctctgcggctggagaccgacaatttcgtcgcg
ttgacgcaaagcagtgccgcccatgcgctggtcggcgtattccttaacgaacaggcgatc
aaaagcaaggccaaagcacaagcgacggatacctccccaccggaaaaagtggcggtgctg
ggcgccggcattatggggggcggcatcgcctaccagtcagcgttgcagggcgtccccgtc
tggatgaaggacatcagcgacaaagcgctcaatctggggatgacggaagcggcgacgctg
ctcggcaaacagttagaacgcggcaaactggacgcggccgcgctgtccggcgtgatggcg
cgcattcatccgacattgaccaacgaaggcgtcgagcaagcggcgttgatcgtcgaagcg
gtcgtggagaacccgcgtatcaaagcgcaggtgctggcggaagcggaagccctgatcggc
gacgacacggtgctggcgtccaatacgtctacaatccccatcgctacgctggcggcggcg
ctaaaacgcccacagcgtttttgcggcatgcattttttcaatccggtacaccgcatgccg
ctggtcgaagtgattcgtgggccgcaaaccgatgagcgcaccctatcgcgcgtggtggcc
tacgccatccggatgggtaaaacccccatcgtggtgaacgactgcccggggttcttcgtt
aaccgggtgctgtttccctatatttcggccttctgcctgttgctgcgcgacggcgcggat
ttccagttcgtggatgccgtgatggaacaacagttcggctggccgatgggcccggcctat
ctgctggacgtcgtggggttggataccgcgcaccatgcccggcaggtgatggcagccggt
tatcccgatcgaatgaggcaggattaccgtgatgtcatcgatgtactgaccgaacaccag
cgcttcggccaaaaaacgggcgcgggcttctaccgttaccaaaccgacaacaaaggcaaa
gcacgcaaagagacggattccggcacagaaacgttgctggcgccggtatgtcagccgtcg
cggacattcagcccggaggagattgtctctcgtatgatgatccccatgctgaacgaagtc
gcgcgttgtctggaagaaggtatcgtcgccagcccggcggaagcagacatggcgctggtc
tacggattgggattcccggcgttccgtggcggcgcctgtcgttatctggatacccagggg
atttcgtcttatctggcgatggcgcaacgctttgttgcattgggcccgctgtatcggata
ccggacagcctgccggacatggctgaacgccggtcgcgttactatgcaccggtcacgccg
catgcgggcctcgctccgcattcaccggattga

DBGET integrated database retrieval system