KEGG   Dickeya zeae Ech586: Dd586_0505Help
Entry
Dd586_0505        CDS       T01138                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ddc  Dickeya zeae Ech586
Brite
KEGG Orthology (KO) [BR:ddc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dd586_0505
Enzymes [BR:ddc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Dd586_0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin NAD_binding_8 DAO FAD_binding_3 Thi4 K_oxygenase AlaDh_PNT_C FMO-like DSBA
Motif
Other DBs
NCBI-ProteinID: ACZ75400
UniProt: D2BRJ6
LinkDB All DBs
Position
563769..565331
Genome map
AA seq 520 aa AA seqDB search
MLDNNVQLQLKTYLEKLTKPVELVATLDDSAKSAEVRALLTDIAGLSDKVSFFENNDLPV
RKPSFLVTNPGAANGPRFAGAPMGHEFTSLVLALLQTGGHPSKEAQELLDQIRDLDGKFH
FETYYSLTCHNCPDVVQALNLMSILNPNVTHTAIDGGVFQDEIKDRNIMGVPTVFLNGEH
FSQGRMSLAEIVGKIDTGANARVVDKLNSRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGAKLATALKTHVDDYDVDVIDVQSAQKLIPASEPG
QPHQIETASGAVLKSRSIIIATGARWRNMNVPGEEQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQAKLRSLPNVDVIVNAQTTEVLGD
GQKVTGLQYKDRTTDSVHKLALEGIFVQIGLLPNTNWLDGAINRNRIGEIEIDARCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaataacgtacaactccagttgaaaacctacctggaaaaattaaccaaacct
gttgagttagtggcgacactggacgactcagcgaaatctgctgaagttcgggctttgctg
actgacatcgccgggttgtccgacaaagtcagtttctttgaaaataacgatctgccggtg
cgtaaaccgtcgtttctggtcaccaacccaggggctgccaacgggccgcgctttgccggt
gcgccgatggggcacgaattcacctcgctggtgctggcgttactgcaaaccggtggacat
ccgtcgaaagaagcgcaagaactcctcgatcaaatccgcgatctggacggtaaattccac
ttcgaaacctattattcgctgacctgtcataactgcccggatgtggtacaggcgctgaat
ttaatgtccatcctgaatccgaacgtgacccatactgcgatcgacggcggtgtgtttcag
gatgagatcaaagatcgcaatatcatgggggttcccacggtattcctgaacggcgagcac
ttcagccagggccggatgagcctggcggaaatcgtcggcaaaattgacaccggtgccaat
gcccgtgtggtcgataagctcaatagccgcccggtgtatgacgtgctgattgtcggcagt
ggcccggcaggggcagccgcggcggtgtacgcggcccgtaaaggcatccgcaccggtttg
atgggcgagcgtttcggcggccagattctggataccgtcgatattgaaaactatatttcg
gtaccgaaaaccgaaggtgccaaactggcgacggcgctgaaaacgcatgtggatgactac
gacgttgacgtcatcgatgtgcagagcgcgcaaaaactgatccccgcttctgaaccgggt
cagccgcaccaaatcgaaactgcgtcgggcgcggtgctgaaatcccgtagcattatcatt
gctaccggtgcgcgctggcgcaacatgaacgtgccgggtgaagaacaataccgtacccgt
ggcgtcacctattgtccgcattgcgacggcccgctgttcaaaggcaagcatgtggcggtg
attggcggcggtaactcaggcgtggaagcagcgattgatctggccggtgtggtgaagcat
gtgaccttgctggaattcgcaccggaactgaaagccgactccgtgttacaggctaagctg
cgtagcctgccgaacgtggatgtgatcgtcaacgcacagaccactgaagtgctgggtgac
ggccagaaagtcactggcttgcagtataaagatcgcaccaccgacagcgttcataagctg
gcgctggaagggattttcgtacaaatcggcctgctgccgaataccaactggctggacggc
gcgattaatcgcaaccgtattggcgaaattgagatagacgctcgctgcgaaaccagtgtg
aaaggtgtgtttgccgccggtgactgcaccaccgtgccttacaagcagattattatcgcc
acgggcgaaggcgcgaaagcctccctgagcgcgtttgattacttgatcagaacgcaggcg
taa

DBGET integrated database retrieval system