KEGG   Dickeya zeae Ech586: Dd586_1849Help
Entry
Dd586_1849        CDS       T01138                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00250  Alanine, aspartate and glutamate metabolism
ddc00410  beta-Alanine metabolism
ddc00640  Propanoate metabolism
ddc00650  Butanoate metabolism
ddc01100  Metabolic pathways
ddc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ddc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Dd586_1849
   00650 Butanoate metabolism
    Dd586_1849
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dd586_1849
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dd586_1849
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ddc01007]
    Dd586_1849
Enzymes [BR:ddc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Dd586_1849
Amino acid related enzymes [BR:ddc01007]
 Aminotransferase (transaminase)
  Class III
   Dd586_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ACZ76709
UniProt: D2BZ14
LinkDB All DBs
Position
2095644..2096909
Genome map
AA seq 421 aa AA seqDB search
MSNSELNQRRLAATPRGVGVMCDFYADKAENATLWDVEGREYIDFAAGIAVLNTGHRHPK
LLAAVREQLEKFTHTAYQIVPYGSYVALAERLNALAPIAGPAKTAFFTTGAEAVENAVKI
ARAYTKRPGVIAFGAAFHGRTLLTLTLTGKVAPYSTGFGPFPGSIFHALYPNAQHGVTVE
QALESIDRILHTDIGADQVAAILLEPVQGEGGFNVAPPEFISGVRQLCDKYGMLLIADEV
QSGFARTGKVFAMEYYNDKADLITMAKSLGGGFPISGVVGRAEVMDAPGPGGLGGTYAGN
PLAVASALAVLDVIEEEQLCQRAQRLGATLVEALEQAKTANPAIADIRARGSMVAVEFTD
PQTGKPSAEITKKYQQAALEQGLLLLTCGTHGNVIRFLYPLTIPDAQFSKALSILAQVLA
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacagcgaattgaatcaacgtcgtttggccgccacgccgcgtggcgtgggtgtg
atgtgtgatttctatgccgacaaggcggaaaacgccaccctgtgggatgttgaagggcgc
gagtatattgattttgcagccgggattgcggtactgaacaccggccaccgtcaccctaaa
ctgctggcggcggtacgcgagcaactggaaaaattcacccacaccgcctaccaaatcgtg
ccttacggcagctatgtggcgctggcagaacgcctgaatgcactggcgccgatcgctggt
cctgccaaaacggctttcttcaccaccggggccgaggcggttgaaaacgcagtgaaaatt
gcccgcgcttacaccaaacgccctggcgtgattgcctttggcgcggcgttccacggccgt
acgctgctgaccctgacgctgaccggtaaagtggctccgtattccaccggtttcggcccg
ttcccagggtccattttccatgcgctgtacccgaatgcccaacacggcgttacggtagaa
caggcgctggagagcattgatcgcattctgcataccgatatcggtgccgatcaggtcgcc
gccattctgctggagccggtacaaggcgaagggggattcaatgtggcaccgccggaattc
attagtggtgtgcgccaactgtgtgacaaatacggcatgttgctgattgccgatgaagta
cagagcggctttgcccgtaccggcaaggtgttcgcgatggagtattacaacgataaagcg
gacctgatcaccatggcgaaaagcctgggtggcggcttcccgatttctggcgtggtaggg
cgtgccgaggtgatggacgcaccgggccccggcgggctgggtggtacctatgcgggtaac
ccgctggcggtggcctcggcgctggccgtactggatgtgattgaagaggaacaactgtgc
cagcgtgcccaacgccttggcgctacactggttgaagcgctggaacaggcgaaaaccgcc
aacccggcgatcgctgatatccgtgcccgtggctcaatggtggcggtggagtttactgac
ccgcaaaccggcaaaccgagcgcggaaatcaccaaaaaataccagcaagcggcgctggaa
caagggctgctgttactgacctgcggtacgcatggcaacgtgatccgttttctgtatccg
ctgaccattccggatgcccagttcagcaaagcactgtctattctggcccaggttctggcg
aagtga

DBGET integrated database retrieval system