KEGG   Dickeya zeae Ech586: Dd586_2033Help
Entry
Dd586_2033        CDS       T01138                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ddc  Dickeya zeae Ech586
Brite
Enzymes [BR:ddc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dd586_2033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACZ76889
UniProt: D2BZY0
LinkDB All DBs
Position
complement(2306078..2306602)
Genome map
AA seq 174 aa AA seqDB search
MKLNALILSGLFISVIAHAASTTVTLKEALPTGDGDTLGNITITETEYGLLFSPNLKGLQ
PGIHGFHVHANASCAPGTQNGNTVPALAAGGHLDPQKTGRHLGPYNDKGHLGDLPGLVAN
ADGSATYEVLAPRLKSLSEVKDHALMVHTGGDNYADTPKELGGGGMRIACGVIQ
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaacgcactgattctgtctggcctgttcatcagcgtcatcgcccatgcggcc
agtacaaccgtcacactgaaagaggcgctacctactggcgatggcgatacgcttggtaat
atcactatcactgaaacagagtatggcctgttgtttagccccaacctgaaagggttgcaa
ccgggcattcatggcttccatgtccatgctaatgccagttgtgcgccaggtacgcaaaat
ggcaatactgtaccggcactggcggcgggtggacatctggatccacaaaaaaccggtcgg
catcttggcccttacaatgataaaggtcatctgggcgatctgcctggtctggtcgccaat
gctgatggcagcgccacgtacgaggtactggcgccacggttgaaatcgctatcggaagtg
aaagaccacgccttgatggttcataccggtggtgacaactacgccgatacaccaaaggaa
ctcggcggcggcggaatgcgcattgcctgcggcgttatccagtaa

DBGET integrated database retrieval system