KEGG   Dickeya dadantii 3937: Dda3937_00317Help
Entry
Dda3937_00317     CDS       T01305                                 

Gene name
glpA
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase (anaerobic), large subunit, FAD/NAD(P)-binding protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00564  Glycerophospholipid metabolism
ddd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dda3937_00317 (glpA)
Enzymes [BR:ddd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Dda3937_00317 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 DAO_C Pyr_redox_2 HI0933_like ADH_zinc_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADN00410
UniProt: E0SKK7
LinkDB All DBs
Position
complement(4512331..4513974)
Genome map
AA seq 547 aa AA seqDB search
MANDGLRRETDVVIIGGGATGAGTARDCALRGLRCLLLERHDIATGATGRNHGLLHSGAR
YAVTDAESARECIEENQILRRIARHCIEPTDGLFLTLPQDDLDYQAQFVAACRQAGIPAQ
AIDPQEALRLEPAANPSLIGAVRVPDGTVDPFRLTAANMIDACEHGAEVLTYHEVIGLIR
QGDRVIGVRVFDHKRHLACEIYAQVVVNAGGIWGQRIAEYADLTVRMFPAKGALLILGHR
INNRVINRCRKPADADILVPGDTISLIGTTSTRIDYDQIDRMTVTPEEVDTLIREGSLLA
PQLAQTRILRAYAGVRPLVASDNDPSGRSVSRGIVLLDHASRDGLEGFVTITGGKLMTYR
LMAEWVTDKVCEKLGHRAECATASRPLPGSEVSDPDRLQAASPLSAPLRGSAIYRHGHRA
APLVSGQRVDSSLVCECEAVTAGEVRYAVESLQVNNLTDLRRRTRVGMGTCQGELCACRA
AGLLCRLGQSTPQQAVSQLSQFLNERWKGMRPIAWGHTLRESEFTSWIYQGLCGLTESRE
QENSDAL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgatggtttgcggcgtgaaacggatgtggtgattatcggcggcggcgccacc
ggcgcggggaccgctcgcgactgcgcattgcgcggtttacggtgcctgttgctggaacgg
cacgacatcgccaccggcgctaccggtcgtaatcatgggctgttgcacagcggggcgcgt
tatgcggttaccgatgccgaatccgcccgcgaatgcattgaagaaaatcagattctgcgc
cgcatcgcccgccactgcatcgagccgaccgacggcctgtttctgacgttgccgcaggat
gacctcgactatcaggcgcagtttgtcgccgcctgtcggcaggcggggatcccggcgcag
gcgatcgatccgcaggaggcgctgcgactggagccggccgccaatccgtcgttgatcggc
gcggtaagggtgccggacggtaccgtggacccgttccggttgaccgccgccaacatgatc
gacgcctgcgagcatggcgcggaagtgctgacctaccacgaagtcatcgggttgattcgc
cagggtgaccgcgtcatcggcgtgcgcgttttcgaccacaaacgccacctggcctgcgag
atttatgcgcaggtggtggtgaacgcgggcggcatctgggggcagcgtatcgctgaatac
gccgacctcaccgtgcgcatgttcccggccaagggcgcgctgctgattctgggccaccgc
atcaacaaccgggtgatcaaccgctgccgtaagccggcggacgccgacattctggtgccg
ggcgacaccatttcgctgatcggcaccacctcgacccgcatcgactacgaccagatcgac
cgcatgaccgttaccccagaggaagtcgataccctgatccgcgaaggcagcctgctggcg
ccgcaactggcgcaaacccgcattctgcgcgcctacgccggggtgcgaccgctggtggcg
agcgataacgacccgtccgggcgcagcgtcagccgcggcattgtgctgctggaccacgcc
agccgggacgggctggaagggtttgtcaccattaccggcggcaagctgatgacctaccgg
ctgatggcggaatgggtgacggacaaggtatgcgagaagctcggccatcgagccgaatgc
gccaccgcgtcacggccgctgccggggtcggaagtctctgatccagacaggctgcaggcc
gcatcgccgttgtcagcgccgttgcgcggctcggcgatttatcgccacggacatcgcgcc
gcgccgctggtttccggccagcgggtggacagcagtctggtgtgcgaatgcgaagcggtg
acggcgggcgaggtgcgttatgcggtggagtcgctgcaggtcaacaacctgactgacctg
cgccgccgtacccgcgtcggcatgggcacctgtcagggggagctgtgcgcctgccgcgcg
gccggtctgttgtgtcggctggggcagtccacgccgcaacaggcggtgtcgcaactgagc
cagtttctcaatgagcgctggaaaggtatgcgtcccatcgcctgggggcatacgttgcgg
gaaagcgaatttaccagttggatttatcaggggctgtgcgggctgaccgaaagccgggag
caggagaacagcgatgcgttatga

DBGET integrated database retrieval system