KEGG   Dickeya dadantii 3937: Dda3937_00990Help
Entry
Dda3937_00990     CDS       T01305                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ddd  Dickeya dadantii 3937
Brite
Enzymes [BR:ddd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dda3937_00990 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADN00635
UniProt: E0SN84
LinkDB All DBs
Position
4766357..4766983
Genome map
AA seq 208 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHSKHHQAYVNNANAALESLPEFAGLSAEELITK
LDQLPADKKGPLRNNAGGHANHSLFWKGLKLGTTLTGELKAAIERDFGSVDAFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTPNQDSPLMGEAISGASGYPIVALDVWEHAYYLQYQ
NRRPDYIKAFWFVVNWDEAAKRFAEAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatccctgccttatgcttatgacgcactggagccgcacttcgac
aagcaaacgatggaaatccatcactccaaacaccatcaggcttacgtcaataacgctaat
gcagcgctggagtccctgcctgagtttgccggcctgtccgccgaagagctgatcaccaaa
ctggatcaactgccggccgacaaaaaaggcccgctgcgtaacaacgccggcggccacgcc
aaccacagcctgttctggaaaggcctgaaactgggtaccacgctgacaggcgaactgaaa
gccgccattgagcgcgatttcggcagcgttgacgcattcaaggaaaaattcgagcaggca
gcagcaacccgtttcggctccggctgggcatggctggtactgaaagatgacggcaaactg
gctgtcgtttccacccccaaccaggacagcccgctgatgggcgaagcgatttccggcgcg
tccggctacccgatcgtcgcactggacgtatgggaacacgcttactacctgcaataccag
aaccgtcgcccggactacattaaagcgttctggttcgtcgtaaactgggacgaagcggct
aaacgttttgctgaagccaaaaaataa

DBGET integrated database retrieval system