KEGG   Dickeya dadantii 3937: Dda3937_01629Help
Entry
Dda3937_01629     CDS       T01305                                 

Definition
(GenBank) superoxide dismutase, Cu, Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ddd  Dickeya dadantii 3937
Brite
Enzymes [BR:ddd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dda3937_01629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ADM98524
UniProt: E0SCK0
LinkDB All DBs
Position
2466944..2467468
Genome map
AA seq 174 aa AA seqDB search
MKLKALILSSLFVSAIAGAASTTVTLKEALPTGDGNTLGDITITETEYGLLFSPSLKGLP
PGIHGFHVHANASCAPGEQNGNKVPALAAGGHLDPQKTGKHLGPYNDKGHLGDLPGLVVN
ADGTASYEVLAPRLKSLSEVKNHALMIHTGGDNYSDMPKELGGGGMRIACGVIQ
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaagcattgattctgtccagcctgttcgttagcgcgatagccggcgcggcc
agcaccacggtaacgctaaaagaggcgctgccgaccggagacggcaatacgcttggtgat
attaccatcaccgaaacagaatacggcctgctgttcagccccagtctgaaaggattgccg
ccgggcattcacggcttccacgtgcatgccaacgccagctgcgcgccgggcgagcagaat
ggcaacaaggtgccggcactggcggccggcggccacctggacccacaaaaaaccggcaaa
catcttggcccttacaacgacaaaggccaccttggcgacctgccggggctggtagtcaat
gccgacggcaccgccagttacgaggtgctggcgccacggctgaaatcgctatcggaggtg
aaaaaccacgcgctgatgatccataccggcggcgataactactcggatatgccaaaagag
ctgggcggcggcggcatgcgtatcgcctgcggcgttattcaataa

DBGET integrated database retrieval system