KEGG   Dickeya dadantii 3937: Dda3937_02057Help
Entry
Dda3937_02057     CDS       T01305                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00620  Pyruvate metabolism
ddd00680  Methane metabolism
ddd01100  Metabolic pathways
ddd01120  Microbial metabolism in diverse environments
ddd01200  Carbon metabolism
Module
ddd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ddd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dda3937_02057 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    Dda3937_02057 (ppc)
Enzymes [BR:ddd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Dda3937_02057 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADN00510
UniProt: E0SLI8
LinkDB All DBs
Position
4635970..4638609
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGANILERVETIRKLSKASRAGSETHRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALATVFRSLKSRDNLSDK
DIRDAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHDDLADYERHQIMRRLRQ
LIAQYWHTDEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLRELDEQMGKELGYRLPVDS
VPVRFTSWMGGDRDGNPNVTSEVTRRVLLLSRWKAADLFLRDVQVLVSELSMTTCTPELQ
QLAGGDEVQEPYRELMKALRAQLTATLDYLDARLKDEQRMPPKDLLVTNEQLWEPLYACY
QSLHACGMGIIADGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDALAEITRYLGLGDYES
WSESDKQAFLIRELNSKRPLLPRQWEPSADTQEVLETCRVIAETPRDSIAAYVISMARTP
SDVLAVHLLLKEAGCPYALPVAPLFETLDDLNNADSVMIQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYRAQDALIKTCEKYGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKFGLPEVTISSLSLYTSAILEANLLPPPEPKQEWHHIMNEL
SRISCDMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVIDDGHQNQLEAMCRDWPFFSTRIGMLEMVFAKADLWLAE
YYDQRLVDEKLWSLGKQLREQLERDIKAVLTISNDDHLMADLPWIAESIALRNVYTDPLN
VLQAELLHRSRQQETLDPQVEQALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaatattccgccatgcggagcaatgtcagcatgctgggtaaactactcggc
gacaccatcaaggatgcgctgggcgccaatatccttgagcgtgttgaaacaatccgcaag
ctgtccaaagcctcgcgggccggcagcgaaacacaccgtcaggaactgctgaccacactg
cagaacctgtccaacgatgaactgctgccggtcgcccgcgcattcagccagttccttaac
ctgaccaacaccgccgagcaataccacagtatctctccgcacggcgaagcggccagtaac
ccggaagcgctggcgacggtgtttcgcagtctgaaaagccgcgacaacctgagcgacaag
gatatccgcgacgcggtggagtcgctctccatcgagctggtgttgaccgcgcacccgacc
gaaatcacccgccgtacgctgatccacaaactggttgaagtgaatacctgcctcaagcag
ctcgatcacgacgatctggccgattatgaacgccaccagatcatgcgccgtctgcgccag
ctgatcgcccaatactggcataccgatgaaatccgcaaaatccgcccgacgccggtggac
gaagccaagtggggtttcgcggtggtggaaaatagcctgtgggaaggggtgccggcgttt
ctgcgcgaactcgacgagcagatgggtaaagagttgggctaccgtctgccggtggattcg
gtgccggtgcgcttcacctcctggatgggcggcgaccgcgacggcaacccgaacgtgacc
tctgaagtcacccgccgcgtgctgctgctaagccgctggaaagccgcggacctgttcctg
cgcgacgtacaggtgctggtttccgaactgtcgatgaccacctgtacgccggaactgcaa
caactggcaggcggcgacgaggtgcaggaaccctaccgcgaactgatgaaagcgctgcgc
gcacagttgactgctaccctggattatctggacgcgcgtctgaaagatgaacaacggatg
ccgcccaaagatctgctggtcaccaacgagcagttatgggaaccgctgtacgcctgttac
cagtcgctgcatgcctgcggcatgggcatcatcgccgatggtcaattgctcgataccctg
cgccgggtgcgctgctttggcgtgccgctggtgcgtatcgacgtacgtcaggagagcacc
cgtcacaccgacgcgctggcggaaatcacccgctatctggggctgggagactacgaaagc
tggtcggaatccgacaagcaggcgttcctgatccgcgaacttaactccaagcgtccgctg
ctgccgcgccagtgggaaccgagcgccgacacccaggaagtgctggaaacctgccgggtg
atcgccgaaaccccgcgcgactccatcgccgcctatgtaatttcgatggcgcgcaccccg
tccgacgtgctggcggtgcatttgctgctgaaagaagccggctgtccgtacgcgctgccg
gtggcgccgctgttcgaaacgctggacgacctgaataacgccgacagcgtaatgatccag
ttgctcaacatcgactggtatcgcggcttcattcagggcaagcagatggtgatgatcggc
tattccgactccgccaaagacgccggggtgatggcggcctcctgggcgcagtaccgcgcg
caagacgcactgatcaagacctgcgagaaatacggcatcgccctgacgctgtttcacggt
cgcggcggttcgattggccgcggcggcgcgccggctcacgccgcgctgctctcccaaccg
ccgggcagcctgaaaggcggcctgcgcgtcaccgaacagggcgagatgatccgctttaag
ttcggcctgccggaagtcaccattagcagcctgtcgctctacacgtccgccattctggaa
gccaacctgttgccgccgccggagccgaagcaggagtggcatcacatcatgaacgagctg
tcgcgcatttcctgcgacatgtaccgcggctacgtacgggaaaacccggatttcgtgccc
tacttccgtgccgccacgccggagctggaactgggcaaactgccgctggggtcacgtccg
gccaagcgtcggccgaacggcggcgtggaaagcctgcgcgccatcccgtggattttcgcc
tggacccagaaccgcctgatgctgcccgcctggttgggcgccggcgccgcgctgcaaaaa
gtgatcgacgacggtcaccagaaccagctggaagccatgtgccgcgactggccgttcttc
tccacccgtatcggtatgctggaaatggtattcgccaaggccgacctatggctggcggaa
tactacgatcagcggctggtggacgagaaactgtggtcgctcggcaaacagctgcgcgaa
cagctggaaagagacatcaaagcggtgttgaccatctccaacgacgaccatctgatggcc
gacctgccgtggatcgccgaatccatcgcgctacgcaacgtctacaccgacccgctcaac
gtgctgcaggcggagctgctgcaccgttcacgccagcaggaaacactggacccgcaggtg
gaacaggcgctgatggtcaccatcgccggcgtcgccgccgggatgcgcaataccggctaa

DBGET integrated database retrieval system