KEGG   Dickeya dadantii 3937: Dda3937_02655Help
Entry
Dda3937_02655     CDS       T01305                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F52a subunit, FAD/NAD(P)-binding protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ddd  Dickeya dadantii 3937
Brite
KEGG Orthology (KO) [BR:ddd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dda3937_02655 (ahpF)
Enzymes [BR:ddd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Dda3937_02655 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like NAD_binding_8 Thi4 FAD_binding_3 DAO K_oxygenase AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: ADM96734
UniProt: E0SJY8
LinkDB All DBs
Position
557186..558748
Genome map
AA seq 520 aa AA seqDB search
MLDNNMQLQLKAYLEKLTKPVELVATLDDSAKSAEVRELLTEIAGLSDKVSFFENNDLPV
RKPSFLITNPGSANGPRFAGAPMGHEFTSLVLALLQTGGHPSKEAKELLDQIRDLDGKFH
FETYYSLTCHNCPDVVQALNLMSVLNPNVTHTAIDGGVFQDEIKDRNIMGVPTVFLNGEH
FSQGRMSLGEIVGKIDTGANARVVDKLNSRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGAKLATALKTHVDDYDVDVIDLQSAQKLIPASEPG
QPHQIETVSGAVLKSRSIIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQNKLRSLPNVDVIVNAQTSEVLGD
GQKVTGLQYKDRVTDSVHKLALEGIFVQIGLLPNTGWLEGAVDRNRIGEIEIDARCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaataatatgcagctccagttgaaagcctatctggaaaaattaaccaaacct
gttgagttagtggcgacgctggacgactcagccaaatccgctgaagttcgggaactgctg
accgaaatcgccgggttgtccgataaagtcagtttctttgaaaataacgatctgccggtg
cgtaagccttcgttcctgataaccaatccggggtcggccaacgggccgcgttttgccggt
gcgccgatgggacatgaatttacctcgctggtgctggcgttgctgcaaaccggtggtcac
ccgtcgaaagaagcgaaagaattactcgatcaaatccgcgatctggacggtaagttccac
tttgaaacctattactcgctgacctgccacaactgcccggatgtggtgcaggcgctgaat
ttaatgtccgttctgaacccgaacgtcacccacaccgcgattgacggcggcgtgtttcag
gatgagatcaaagaccgtaatatcatgggggtgcccacggtattcctcaacggcgaacat
ttcagccagggccgcatgagcctgggggaaatcgtcggtaagatcgacaccggcgccaac
gcccgcgtggtcgacaagctgaacagccgcccggtgtatgacgtgctgatcgtcggcagt
ggcccggcgggcgcggcagcggccgtatacgcggcccgtaaggggatccgcaccggtctg
atgggcgagcgtttcggcggccagattctggataccgtcgatatcgaaaactacatttcg
gtgccgaagaccgaaggcgccaaactggcgaccgcgctgaaaacccacgtggacgactac
gatgtcgatgttatcgatctgcagagcgcgcagaaactgattccggcttccgaaccgggc
cagccgcaccagattgaaaccgtctccggtgcggtgctgaaatcccgcagcatcatcatt
gccaccggcgcgcgctggcgcaacatgaacgtgccgggcgaagatcagtaccgcacccgc
ggcgtgacctattgcccgcactgcgacggcccgctgtttaaaggtaagcacgtggcggtg
atcggcggcggcaactccggcgtggaagcggccatcgacctggcgggtgtggtgaaacac
gtgaccctgctggagtttgcgccggaactgaaagcggattcggtgttgcagaacaaactg
cgcagcctgccgaacgtggacgttatcgtgaacgctcagaccagcgaagtgctgggcgac
ggccagaaagtcaccggcctgcagtacaaggatcgcgttactgacagcgttcacaagctg
gcgctggaagggattttcgtgcagatcggcctgctgcccaacaccggttggctggaaggc
gcggttgaccgcaaccgtatcggtgaaatcgagatcgatgcccgctgcgaaaccagcgtg
aaaggcgtatttgcggcgggcgactgcaccaccgtgccttacaagcagatcattatcgcc
accggcgaaggcgccaaggcttccctgagcgcgtttgattatctgatcagaacccaggcg
tga

DBGET integrated database retrieval system