KEGG   Dickeya dadantii 3937: Dda3937_03108Help
Entry
Dda3937_03108     CDS       T01305                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00061  Fatty acid biosynthesis
ddd00780  Biotin metabolism
ddd01100  Metabolic pathways
ddd01130  Biosynthesis of antibiotics
ddd01212  Fatty acid metabolism
Module
ddd_M00083  Fatty acid biosynthesis, elongation
ddd_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ddd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Dda3937_03108 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Dda3937_03108 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Dda3937_03108 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddd01004]
    Dda3937_03108 (fabI)
Enzymes [BR:ddd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Dda3937_03108 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Dda3937_03108 (fabI)
Lipid biosynthesis proteins [BR:ddd01004]
 Fatty acid synthase
  Component type
   Dda3937_03108 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ADM98855
UniProt: E0SG00
LinkDB All DBs
Position
2837060..2837851
Genome map
AA seq 263 aa AA seqDB search
MGFLNGKRILVTGVASNRSIAYGIAQAMHREGAELAFTYQNDKLKSRVEEFAKEFDSSIV
LPCDVAEDASIDALFAELAKVWPKFDGFVHSIAYAPGDQLDGDYVNAVTREGFAIAHDIS
AYSFVAMAKACRSMLNPNSALMTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGRD
GVRVNAVSAGPIRTLAASGIKNFKKMLSHCEAVTPIRRVVTIEDVGNAAAFMCSDLAAGI
SGEVLHVDGGFNIAAMNELELGD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcttaacggtaagcgcattctggtaacgggcgttgccagcaaccgctccatc
gcatacggtatcgcacaggctatgcatcgcgaaggtgcagaactggcgttcacctaccag
aacgacaagctgaagtcacgtgtggaagagtttgccaaagagttcgattcaagcatcgtt
ttgccgtgtgatgttgcggaagatgccagcattgacgcgctgttcgccgaactggcgaaa
gtctggccgaaattcgacggcttcgtacactccatcgcttacgcgccgggcgaccagctg
gacggcgactacgtgaacgccgtcacccgtgaaggttttgccatcgctcacgacatcagc
gcctacagctttgtggcgatggcgaaagcctgccgcagcatgctgaacccgaactccgcg
ctgatgactctgtcctacctgggtgccgagcgcgccattccgaactacaacgtgatgggc
ctggcgaaagcgtcgctggaagccaacgtgcgctacatggccaacgccatgggccgcgac
ggcgtgcgcgtcaatgccgtttccgcgggtccgatccgcacactggcggcgtccggcatc
aagaacttcaaaaagatgctttctcactgcgaagcggtcaccccgatccgtcgcgtggtc
accattgaagatgtgggcaacgccgcggccttcatgtgttccgacctggctgccggtatc
tccggtgaagttctgcacgttgacggcggcttcaacattgccgcgatgaacgaactggaa
ctgggcgattaa

DBGET integrated database retrieval system