KEGG   Dickeya dadantii 3937: Dda3937_04212Help
Entry
Dda3937_04212     CDS       T01305                                 

Gene name
yfcG
Definition
(GenBank) Maleylacetoacetate isomerase / Glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ddd  Dickeya dadantii 3937
Brite
KEGG Orthology (KO) [BR:ddd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dda3937_04212 (yfcG)
Enzymes [BR:ddd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Dda3937_04212 (yfcG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ADM99290
UniProt: E0SKK1
LinkDB All DBs
Position
3301378..3302007
Genome map
AA seq 209 aa AA seqDB search
MIDVYYAPTPNGHKITLFLEEAQLPYQLHRIDISAGEQFKPEFLAISPNNKTPAIVDQQP
ADRGAPISLFESGAILLYLAEKTGKLLSADVRERADTLQWLFWQMAGFGPMLGQNHHFNH
YAPQPVPYAIDRFQKETERLYGVLNKQLHDHAWLAGNEYSIADIATYPWVVLHDRQRIDI
DAFPAVKSWFERIRERPATQRAYQLAAKV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtgtactacgcccctaccccaaacggtcacaaaatcaccctgttcctggaa
gaagcacagttaccttatcaactgcaccgcatagatatcagtgcaggcgagcagttcaaa
cccgaattcctggcgatttcccccaacaacaagacccctgccatcgtggatcaacagccc
gccgatcggggcgcgccgatcagcctgttcgaatccggagccattctgctctatctggcc
gaaaaaaccggcaagctattgagcgccgacgtacgggagcgcgccgacaccctgcaatgg
ttgttctggcagatggccggtttcgggccgatgctggggcaaaaccatcacttcaaccac
tatgcgccccagccggtgccttacgctatcgaccgcttccagaaggaaacggagcggctg
tatggggtgctaaataaacaactgcatgaccacgcctggctggcgggcaatgagtacagc
attgccgacatcgccacctatccgtgggttgtattacacgatcgccagcgcatcgatatt
gacgccttcccggcggtgaaaagctggtttgagcgcatccgcgagcgcccggccacgcag
cgcgcctaccagctcgcggcgaaagtctga

DBGET integrated database retrieval system