KEGG   Desulfovibrio alaskensis: Dde_0366Help
Entry
Dde_0366          CDS       T00294                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00473  D-Alanine metabolism
dde00550  Peptidoglycan biosynthesis
dde01100  Metabolic pathways
dde01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Dde_0366
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dde_0366
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Dde_0366
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dde01011]
    Dde_0366
Enzymes [BR:dde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Dde_0366
Peptidoglycan biosynthesis and degradation proteins [BR:dde01011]
 Precursor biosynthesis
  Amino acid ligase
   Dde_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ABB37167
UniProt: Q316H9
LinkDB All DBs
Position
357058..357984
Genome map
AA seq 308 aa AA seqDB search
MRILLIAGGWSEERDVSLSGARGIHAALERLGHQVTLFDPCRTLAGLLEAAQAHDFAFLN
LHGQPGEDGLVQALLETAGVPYQGSGPAGSFLALNKAAAKEVFVRNGLPTPEWVFLPAHP
GADWEPPFAFPAFIKSNNGGSSLALHRVSCPGELARALDELFTRGGEAIIEPAVEGVEVT
CGVLGDEALPPILIRPLGAGFFDYASKYTPGQAEELCPAPLPGEVTAKVREYALRAHRAL
GLRGYSRSDFILTPAGALSLLEVNTLPGMTATSLLPQEAAAVGISFDGLIGRLIELGLAA
HGKQQEKA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattcttttgatagccgggggctggtctgaggaacgggacgtatcgctttccggt
gcgcggggcattcacgccgcgctggagcggctggggcatcaggttactctttttgacccc
tgccggacgcttgcgggccttctggaggctgcacaggcacatgatttcgcctttttaaac
ctgcacgggcaaccgggagaagacggccttgtgcaggcgctgctggaaacggccggcgtg
ccgtatcaggggtccggccctgcggggtcttttctggcgctgaacaaggccgcggcaaag
gaagtgtttgtcagaaacggcctgcccacaccggaatgggtttttctgccggcgcatccg
ggagcggactgggagccgcctttcgcttttccggcatttatcaagtccaacaacggcgga
tcaagccttgctctgcaccgcgtcagctgcccgggcgagcttgcccgcgcgcttgacgag
cttttcacccgcggcggcgaggccattatagaacccgccgtggaaggcgtggaggtgact
tgcggtgtgctgggcgacgaagccttgccgcccattctcatccgtccgctgggcgccgga
ttttttgattatgccagcaaatacactccggggcaggcggaagaactgtgtcccgcgccg
ctgcccggagaagttacggccaaggtgcgcgaatacgcgctgcgggcgcaccgcgcactg
gggctgcgcggttacagccgttcagattttattctgacgcctgccggagcattgtccctg
ctggaagtgaacacgctgccgggcatgacggccacaagcctgctgccgcaggaagcggct
gccgtgggcatttcctttgacgggttgatcgggcggcttatcgagctgggactggccgcc
cacggcaaacaacaggagaaggcatga

DBGET integrated database retrieval system