KEGG   Desulfovibrio alaskensis: Dde_1006Help
Entry
Dde_1006          CDS       T00294                                 

Definition
(GenBank) Enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00061  Fatty acid biosynthesis
dde00780  Biotin metabolism
dde01100  Metabolic pathways
dde01130  Biosynthesis of antibiotics
dde01212  Fatty acid metabolism
Module
dde_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Dde_1006
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Dde_1006
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Dde_1006
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dde01004]
    Dde_1006
Enzymes [BR:dde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Dde_1006
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Dde_1006
Lipid biosynthesis proteins [BR:dde01004]
 Fatty acid synthase
  Component type
   Dde_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ABB37807
UniProt: Q313T9
LinkDB All DBs
Position
complement(1029017..1029781)
Genome map
AA seq 254 aa AA seqDB search
MLLKDKKILILGVANNKSIAYGIAQEFKAQGARLAFSYPGEAIQKRVDPISEELGGEFTF
RLDVTDDAQVAAAVRTVEEQWGSVDVVVHSIAFAQREDLHGRFIDTSREGFKLAMDISAY
SLVCVCKAFEPLMTEGGSVLTMTYYGSQKVITNYNVMGVAKAALEASVRYLAADMGERGI
RVNAVSAGPIKTLAASGISGFKTILNHIEEHAPLRRNVTTQDVGRTAVFLASDLSGAVTG
EVLFVDAGYNVMGI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgaaagataaaaaaattcttattcttggcgtggccaataacaaaagtatcgcc
tacggcattgcacaggaattcaaggctcagggcgcacggctggccttcagctaccccggc
gaagccatccagaaacgtgtggaccccataagcgaagagctgggcggcgaattcaccttc
cggctggatgtcaccgacgatgcgcaggtggccgcggcagtgcgcacagtggaagaacaa
tggggcagcgtggacgtggtggttcattccatcgcttttgcccagcgcgaagacctgcac
ggcagattcatcgataccagccgcgaaggtttcaagctggccatggatatttccgcctat
tctctggtctgtgtgtgcaaggcgtttgaaccgctgatgacagaaggcggttccgtgctt
accatgacatactacggctcgcagaaagtcataaccaactacaacgtaatgggcgtggcc
aaggccgctctagaagcctccgtcagatatctggctgcagatatgggcgaacggggcata
agagtgaacgcagtgagcgcaggtcccatcaaaacgctggcagccagcggcatttccggc
tttaaaaccatcctcaaccacattgaggaacacgcaccgctgcgccgcaatgtaaccacg
caggacgtaggccgcacagccgtgtttctggcatcggacctttccggcgccgtcaccggc
gaagtgctgtttgtggacgcgggctacaacgtgatgggcatttag

DBGET integrated database retrieval system