KEGG   Desulfovibrio alaskensis: Dde_1020Help
Entry
Dde_1020          CDS       T00294                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00970  Aminoacyl-tRNA biosynthesis
dde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dde00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dde_1020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dde03029]
    Dde_1020
Enzymes [BR:dde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dde_1020
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dde_1020
Mitochondrial biogenesis [BR:dde03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dde_1020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABB37821
UniProt: Q313S5
LinkDB All DBs
Position
complement(1043225..1044688)
Genome map
AA seq 487 aa AA seqDB search
MAQIYAQTLTETAAALAQGTLTAEEAVRACIDRIEATEPAVHALLATRCEEALAEARAMD
AAGYDPAKPLWGVPVTVKDVLSTSGVATTCGSRILENYVPFFDAAAVSRLKDAGAVILAK
TNMDEFAMGSSTEKSAFKTTHNPWDLQRVPGGSSGGSAASVAAGQCFASLGTDTGGSVRQ
PASFCGCVGLKPTYGRVSRYGLVAYGSSLDQIGPVTRSVEDAARVLAVIAGHDARDTTCS
DRPVDDYLAALGSRSDLAGLRIGVPAEYWGEGLSGEVDSCCREALKKAEELGATLVDISL
PNSRHAIAVYYIVAMAEASSNLARFDGVRFGHRSDNAASLPELYINSRSEGFGDEVQRRI
MLGTYVLSSGYYDAYYRKAAQVRRLILQDFEKAFEQCDVICGPASPVTAWKHGAMSGDPL
TMYLLDIFTISLNLAGLPGLSLPVGTGTESGMPVGLQILGKAFDEATLLSVAHVLEQRIG
RTPVAQI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatatacgcacagacacttactgaaaccgccgccgcgctggcacagggcaca
ctgacagccgaagaggccgtcagagcatgcatagaccgcatcgaagctaccgaaccggca
gtgcacgcgctgctggccacccgctgcgaagaagcgctggccgaagcccgggccatggac
gccgcgggttatgaccccgccaaacccctgtggggcgtgcccgtcaccgtcaaggatgta
ctgagcaccagcggtgttgccaccacctgcggctcgcgcatactggaaaattacgtgcct
ttttttgatgccgccgccgtgtcgcgccttaaagatgcaggtgccgtcattctggcaaag
accaacatggatgaattcgccatggggtcttccaccgaaaagtcggcatttaaaaccacc
cacaacccgtgggacctgcaaagagtacccggcggttcgtccggcggatctgccgcttcc
gtggccgccggtcagtgttttgcatcgctgggtaccgataccggcggctccgtgcgccag
cctgcctccttctgcggatgcgtggggctgaagcccacatacggccgcgtttcacgctac
gggctggtggcctatggttcttcgctggaccagataggtcctgtcacccgcagcgtggaa
gacgccgccagagtgcttgccgtcattgccggacacgatgcccgcgacaccacatgttcc
gacagaccggtggatgattatctggccgctctcggctcccgcagcgaccttgccggactc
cgtataggcgtaccggcggaatactggggtgaaggactttccggcgaggtggattcctgc
tgccgtgaagccctgaaaaaagccgaagaactgggtgccactctggtcgacatatccctg
ccgaacagccggcacgccattgcggtgtactacatcgtggccatggccgaagccagctcc
aatctggcccgcttcgacggggtgcgtttcgggcaccgctcggacaacgcggcttcactg
cccgaactgtacataaactcccgttccgaaggattcggcgacgaagtgcagcgccgcatc
atgctgggcacctatgtgctttcttccggctactacgatgcgtactaccgcaaggccgcg
caggtccgcaggcttattctgcaggattttgaaaaagcctttgagcagtgcgatgtcatc
tgcggccctgcttcgcccgttacagcatggaaacacggagccatgtccggcgaccccctg
accatgtatctgctggatattttcaccatatctctcaaccttgcggggctgcccggtctt
tctctgcctgtgggtacgggaacggaatcaggcatgcctgtggggctgcagattctgggc
aaggcctttgacgaagctacattgctctctgtggcccatgtgcttgaacaacgcataggc
cgcacccccgtggcacagatataa

DBGET integrated database retrieval system