KEGG   Desulfovibrio alaskensis: Dde_1043Help
Entry
Dde_1043          CDS       T00294                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00471  D-Glutamine and D-glutamate metabolism
dde00550  Peptidoglycan biosynthesis
dde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Dde_1043
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dde_1043
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dde01011]
    Dde_1043
Enzymes [BR:dde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     Dde_1043
Peptidoglycan biosynthesis and degradation proteins [BR:dde01011]
 Precursor biosynthesis
  Amino acid ligase
   Dde_1043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ABB37844
UniProt: Q313Q2
LinkDB All DBs
Position
1071436..1072800
Genome map
AA seq 454 aa AA seqDB search
MIGKVFRIHMVGIGGTGMCGIAEVLLNLGFEVRGSDMNDSPSVRRLRRLGADIFIGHGAE
NVTDAQVLVKSTAVSMDNPEVQAAQEKGIPIIPRAEMLAELMRLRKGIAIAGTHGKTTTT
SLTAAIFDEAGTDPTVIIGGRLNAYGSNARLGEGEFLLAEADESDGSFLCLSPVVNVVTN
VDLDHVDFYHDQQAIDTAFINFMNKVPFYGMNVVCGDDAGVRRLLPQIKRPVLTYGFGPD
NQLRAETVTCGETSRFRVLLHGEDLGEVNLVQPGRHNVLNALAAIGVGLETGIAADVCLR
GLANFRGVGRRFERKGERGGVLVVDDYGHHPAEIAATLATARTCYPGRRLVVAFQPHRFS
RTKALFGDFCKAFDNVDKLLLTEIYPASEAPIPGVSGQSLAQGIRQVSNTDVDYFQDFDA
MRAALPETLRPGDLFLTLGAGSIWTVGQFYLDGE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggaaaagttttcagaattcatatggtcggcataggcggcacgggaatgtgcggc
atagccgaggtgcttctcaatctcggtttcgaagtgcgcggctccgacatgaatgacagt
ccttccgtgcgccgtctgcgccgtctgggggcagatattttcatcggccacggtgccgaa
aacgtgacggacgcacaggtgctggtgaaatcgacagccgtgagcatggataatccggaa
gtgcaggccgcgcaggaaaagggcattcccattattccgcgtgccgaaatgctggccgaa
ctgatgcggctgcgcaagggcatagccatagcaggcacccatggcaaaaccaccaccaca
tcgcttacggcagccatttttgacgaagccggtaccgaccccaccgtcatcatcgggggc
agactgaatgcatacggctccaatgcacggctgggagaaggcgaatttctgctggccgaa
gctgacgagtccgatggatcgttcctgtgtctgtcgccggtggtcaatgttgtgaccaat
gtggatctggaccatgtggacttttatcatgatcagcaggccatcgacacagcgttcatc
aacttcatgaacaaggtgcctttttacggcatgaacgtggtgtgcggtgatgacgccggt
gtgcggcgcctgcttcctcagatcaaacggcctgtgcttacctacggtttcggtcccgac
aatcagttgcgggccgagactgtaacctgcggcgagaccagccggttcagggtgctgctg
catggcgaagatctgggcgaagtgaatcttgtgcagcccggcagacacaatgtgcttaac
gcgctggcagccataggtgtggggctggaaacaggcatcgcggcggatgtatgtctgcgc
ggacttgccaacttccgcggagtggggcgcaggtttgagcgcaaaggcgagcgcggcgga
gtgctggtcgtggacgactacgggcaccatccggcggagattgcggcgactcttgccacg
gcgcgcacgtgctaccccgggcgcaggcttgtggtggcttttcagccgcaccggttcagc
cggaccaaggcgctgttcggcgacttctgcaaagcttttgacaacgtggacaagttgctg
ctgacggaaatttatcctgcgagtgaggctcccataccgggggtcagcggtcagagtctg
gcgcagggaatccggcaggtaagcaataccgatgtggattactttcaggattttgatgcc
atgcgtgccgcactgccggaaacgctccggccgggtgatctttttcttactcttggcgcc
ggcagcatctggacggtgggacagttttatctggacggggaataa

DBGET integrated database retrieval system