KEGG   Desulfovibrio alaskensis: Dde_1424Help
Entry
Dde_1424          CDS       T00294                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00500  Starch and sucrose metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dde_1424
Enzymes [BR:dde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Dde_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ABB38223
UniProt: Q312C3
LinkDB All DBs
Position
complement(1448849..1451413)
Genome map
AA seq 854 aa AA seqDB search
MHPVKVFNVTPRLPEGLEPLWDLAYNFWFAWNAGIEELFAQIDYRLWQRCAKNPVEFLNN
VPQATLRELAADAIYKERLAEAHQQLQRYLGAPVDKDFHIEDERQPVVAYFSLEFGVSTC
LPIYSGGLGILAGDHLKSASDLNLPLIGIGLAYRQGYFRQYMTPDGWQQERYPDYDFEQM
PLTAATAPDGTAAMVRLNIGDRPLAARIWKAQVGRVALYLLDTNIPENPPDFREVTARLY
GGGLEMRLWQEILIGIGGIKALEALGLNPKVIHMNEGHSAFAGLERVRLFMKNCGLSFEA
ALELAASSSVFTTHTPVPAGNDRFPPDLMQRYFEPYSRDMGLAFKVFLALGRENPHDDGE
PFCMTVLALRLSRFNNGVSILHGKVSRNMWKQVWNQYPVEDIPIGALTNGVHAPSWVAPD
IQSLFDRYLGPNWREDPDCQRVWGQADSISDAELWRTHERLRARLVDYVRGRLIRQLTAQ
GARKADLQVAQEVLNPEALTIGFSRRFATYKRANLLLQNKERLIRLVTDKERPVQFIFAG
KAHPQDQAGKQIIKEIISLCRTEECRYSMVFLEDYDMDVAAHLVSGCDIWLNNPRRPLEA
CGTSGMKAMLNGVLQFSTLDGWWDEAYLPDNSLGWAIGKGEEYEDLEYQDFVEIQTLYNI
LEKDIVPEFYDRGHGGMPRAWVGRMKNAIRQLGPRFNSHRMVEDYKATAYLPAYENYLRL
TSDSFARARELASWRMDMMTRWGQVSIHNVRAYEHESIHVGQTVTVEAAVALNGIAPESI
LVEVYAGPVGLDGSFAGRTIYPMEPAEETQDGMRMYRGKATPLEAGRFGFTVRAVPSHPL
LLDPHSLGLIRWAS
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccgtaaaggtattcaatgtcactccccggcttccggaagggctggaaccgctg
tgggatctggcgtacaatttctggtttgcgtggaacgcaggcatagaagagctttttgcc
cagatagactacaggttgtggcagcgctgcgccaaaaaccccgttgaatttctgaacaat
gtccctcaggcaacgctgcgggaactggccgcggacgccatctacaaggaacgtcttgca
gaagctcaccagcagctgcaacgttatctgggcgctccggtggacaaagactttcatatt
gaagacgaacgccagccggtggttgcctatttcagtctcgaattcggcgtttccacctgt
ctgcccatttattccggcgggctgggcattcttgccggcgatcatctgaaatctgccagc
gacctgaatctgccgcttatcggtatcggactggcataccggcaggggtacttccgccag
tacatgacccccgacggctggcagcaggagcgctaccccgactatgattttgaacagatg
cccctgacagcggccacggcaccggacggcaccgcagccatggtgcggctgaacataggc
gaccgcccccttgccgcacgcatatggaaagcacaggtgggcagagtggccctgtacctg
ctggacaccaatattccagaaaacccgccggatttccgtgaagtaaccgcgcgcctgtac
ggcggcggactggaaatgcgtctgtggcaggagatacttataggcataggcggcataaag
gcattggaagcgctggggctgaaccccaaagtcatacacatgaacgagggacattccgcc
tttgccgggctggaacgcgtgcgcctgttcatgaaaaactgcggactgtctttcgaggcg
gcgctggagctggcggcctcaagttccgtatttaccacgcacacccccgtgcccgccggc
aacgaccgttttccgccggacctcatgcagcgctatttcgaaccgtattcccgcgatatg
gggcttgccttcaaggtttttctggccctcggcagagaaaacccgcacgacgacggcgaa
cctttctgcatgaccgtgcttgcgctcagactttcgcggttcaacaacggcgtgtccata
ttgcacggcaaagtttcgcgcaacatgtggaaacaggtctggaaccagtatccggtggaa
gacattcccataggcgctctgaccaacggagttcacgctccttcgtgggtagcccccgac
atacagtcgctgttcgacagatatctgggccccaactggcgcgaagatccggactgccag
cgcgtatgggggcaggcggacagcatatccgacgcggagctgtggcgcacgcacgaaagg
ctgcgcgcacggctcgtggactatgtccgcggcagacttatccgtcagcttacagcgcag
ggggcccgcaaagcagacctgcaggtggcgcaggaggtgctcaatcccgaagccctgacc
ataggcttttcacgccgttttgccacatacaagcgggccaacctgctgctgcagaacaaa
gaacgccttatcaggctggtcacggacaaggaacgtcccgtgcagttcatctttgccggc
aaagcccacccgcaggatcaggccggcaaacagataatcaaggaaataatatccctgtgc
cgcacggaagaatgccgctacagcatggtctttctggaagactacgacatggacgtggcg
gcgcatcttgtttccggctgcgacatatggctcaacaatccccgcagaccgctggaagcc
tgcggcaccagcggcatgaaagccatgctcaacggcgtgctgcagttcagcactctggac
ggatggtgggacgaagcctacctgcccgacaacagcctgggatgggccataggcaaaggt
gaagaatacgaagaccttgaatatcaggatttcgtggaaatacagactctctacaatatt
cttgaaaaagatattgttccggagttttacgaccgcggacacggcggcatgccgcgcgca
tgggtgggccgcatgaaaaatgccatcaggcagctgggccccaggttcaactcgcaccgc
atggtggaagactataaggccacggcctatctgcccgcatatgaaaactacctgcggctt
accagcgacagtttcgcccgtgcccgcgaactggcatcatggcgcatggacatgatgacc
cgctgggggcaggtgtccatacacaacgtgcgtgcctacgaacacgaatccatacatgtg
ggacagacagtgacggtggaagccgccgtagcgctgaacggcatagcccccgaaagcatt
cttgtagaagtatacgcagggccggtggggctggacggcagttttgccggcaggaccatc
tatcccatggaaccggccgaagaaacacaggacggtatgagaatgtacagaggaaaggca
accccgctcgaagcaggcaggttcggctttaccgtgcgggccgtgccgtctcatccgctg
ctgcttgacccccattcgctcgggctcatacgctgggcttcataa

DBGET integrated database retrieval system