KEGG   Desulfovibrio alaskensis: Dde_2353Help
Entry
Dde_2353          CDS       T00294                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00500  Starch and sucrose metabolism
dde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dde_2353
Enzymes [BR:dde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dde_2353
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Dde_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: ABB39150
UniProt: Q30YU6
LinkDB All DBs
Position
complement(2373604..2376936)
Genome map
AA seq 1110 aa AA seqDB search
MSIMIEPAGLDPQWYRDAIIYELHIKSFHDSDGDGMGDMAGLIEKLDYLQDLGVTALWLL
PFYPSPLRDDGYDIADYMSINPDYGSMADFRKLLREAHSRGLRVITELVLNHTSDQHAWF
RRARRAPAGSEERDFYVWSDTSDRYKDARIIFKDFEPSNWSWDPVARAYYWHRFYHHQPD
LNYENPAVHKAMFRVIDFWLDMGVDGVRLDAVPYLYEEEGTNCENLPRTHDFLKALRSHI
DSRFQGRMLLAEANQWPEDAARYFGDGDSCHMAFHFPLMPRMFMAIEMEDRHPVIDIMEQ
TPELPDGCQWAIFLRNHDELTLEMVTDEERDYMYRMYARDPRARINLGIRRRLAPLLGND
RRRVELLNVLLFTMPGTPVLYYGDEIGMGDNYYLGDRDGVRTPMQWSADRNAGFSRSNPQ
RLFLPVVIDPEYHYEAVNVETQQSNKSSLLWWMKRIIAMRRRYTAFSRGGISFLRPENSR
VLAYMRSSGEEHVLVVTNLSRHAQAASLDLSGWEGYRPVEVFSNTRFPAVRQPAYTITLN
PYGYYIFHMRREEAAEALTGLFSPPMLMPVSGARFLDVEVREALQRRVLPGYLTRRGLLG
TSAVQLREAVILEAVPVGGKGAPSWLLIVEARYQERQPEWFGMLVSLLAGEPARQTVREA
PVHLMCTFGEDAPEAVLVESFDASCRCGALLQLVSRTQTVKGRHGELAVAPAGGTRGRVR
AACAEDAPALWKPHIHATSVVCGESVLFKVYRRMDEGVNPDVELLRFLTEEAGYPHVPAY
MGVVEYRRSRTSSMAVAMLHEYVQAQGDAQEMCRDMVRRFFDRVLAARGEMDIRPRLYAR
SPVEAAGRPLPQEYRELMGDMDFAGMQLLGRRVGELHRALAFSSEDSAFAPEPFSTLYQR
SVYQGMQSRVKQVLTRLERSLALLPESARDDAARVLELREEALRRMRGFLTRKLDCLKIR
VHGNLHLGNVLRSGREYVIVNFEGRPDKSLSERRLKRSPLRDVADLVRSVHYTVLTVLMH
ESVLRPEDRAFLEPWADLWRIEASGAFMTTYLEAVGGSRLVPENEQGVQVLLEAFLLEKA
FMELDAELKAPSGMVGLPLAAIITLLGAEG
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgagcattatgattgagccggcgggccttgatccgcagtggtacagggatgccatcata
tacgaattgcacatcaaatcgtttcatgattccgacggcgacggcatgggcgatatggcg
gggctgattgaaaaactggactatctgcaggatctcggggtcacggcgctgtggctgctg
cccttttacccctctccgctgcgtgatgacggctacgatattgccgactacatgagcatc
aaccccgactacggcagcatggctgacttccgcaagctgctgcgcgaggctcattcccgc
gggttgcgcgtcattacagaactggtgctcaaccacacctcagaccagcatgcctggttc
cggcgggcgcggcgggcccctgccggttcggaagagcgcgatttttacgtgtggagcgat
acctcggacaggtacaaggacgcccgcatcattttcaaagacttcgagccttcaaactgg
tcatgggaccctgtggcacgggcatattactggcatcgtttctatcatcaccagcctgat
ctcaattatgaaaatccggccgtgcacaaggccatgttccgggtcatcgacttctggctg
gacatgggggtggacggagtgcggctggatgctgtgccctatctgtacgaagaagaaggc
acaaactgcgaaaatctgccgcggacccatgattttcttaaagcgttgcgcagccacata
gacagcagatttcagggccgcatgctgctggccgaggcgaaccagtggccggaagacgcg
gcccgttatttcggcgacggtgattcgtgtcatatggcatttcattttccgcttatgccg
cgcatgtttatggccattgaaatggaagaccgtcatccggtcattgatataatggagcag
actccggaactgccggacggttgccagtgggctatttttctgcgtaaccatgacgaactg
acgctggagatggtgacggacgaagagcgcgactacatgtaccgcatgtatgcccgtgat
ccgcgtgcgcggataaatctcggcatccgccgccgccttgccccgctgctgggcaacgac
cgccgcagagtggagctgcttaacgtgctgcttttcaccatgccggggacaccggtgctt
tattatggtgacgagataggcatgggggacaactactatctgggcgaccgcgacggtgtg
cgtacccccatgcaatggagtgcggacagaaacgccggtttttcacgctccaatccgcag
cgtctttttctgccggtggtcatcgatccggaataccactacgaggctgtgaatgtggaa
acgcagcagtccaacaaaagttcgctgctgtggtggatgaagcgcatcatcgccatgcgc
agaagatatacggctttcagccggggcggcatttcgtttctccggccggaaaactcccgt
gtgcttgcctacatgcgcagctctggtgaagaacatgtgctggtggtgactaacctgtcg
cggcacgcacaggcagcttcgctggatttaagcggctgggaaggctaccggccggtggaa
gtcttcagcaacacgcgctttcccgctgtcaggcaaccggcgtatacaattacgctcaat
ccttacggctactatattttccacatgcgcagagaggaggcggcggaagcgcttaccgga
ttattttcgccgcctatgctcatgccggtgtccggagcgcgttttcttgatgtggaagta
cgcgaggcgctgcagcgcagagttctgcccggctatctgacacgtcgcggattgctggga
acaagcgccgtgcagctgcgcgaggctgtcattctggaagcggtgcccgtgggcggcaag
ggtgcccccagctggttgctgattgtggaagcacggtatcaggagcgccagccggaatgg
ttcggcatgcttgtatcgttgctggctggtgaacctgcccggcagacggtgcgtgaagcg
cctgtgcatctcatgtgcacttttggtgaagacgcgccggaagccgtacttgtggaatcc
tttgatgccagctgccgttgcggcgcgttgctgcagcttgtctcgcgcacgcagacagtg
aagggcaggcacggcgagctggcagtggcccccgccggcggtacccgcggcagagtgcgg
gcggcctgcgccgaagatgctcctgccctgtggaagccccatatccacgccaccagcgtt
gtctgcggtgaaagtgtgcttttcaaggtgtaccgccgcatggacgaaggtgtgaatccg
gatgtggaactgctgcgctttctgaccgaagaggcggggtatcctcatgtgcccgcgtat
atgggcgttgtggagtacagacggtcgcgcacatcgtccatggctgtggccatgctgcat
gaatatgtgcaggcgcagggcgacgcacaggaaatgtgccgcgatatggtacgcaggttc
tttgacagggtgctggccgcacggggcgagatggatatccgtccccggctgtatgcccgt
tctcccgtggaagccgcaggaagacctttgccgcaggaataccgtgaacttatgggcgat
atggattttgccggcatgcagctgctgggcaggcgtgtgggcgaactgcaccgcgcgctg
gcgttcagctctgaagactctgcttttgctccggagccgttttccaccctgtatcaacgg
tctgtgtatcagggtatgcaaagccgggtaaagcaggtcctgacccgtctggaacgttcg
cttgctttgctgccggaatcggccagagacgatgctgcgcgggtgctggaactgcgcgaa
gaagctttgcggcgcatgcgcggttttcttacgcgcaaacttgattgtctgaaaatcagg
gtgcatggcaacctgcatctgggcaatgtgctgcgcagcggcagagagtatgtgatcgtg
aactttgagggcaggccggacaagtctctttccgaacggaggctgaagcgttcacccctg
cgcgatgtggcagatctggtacggtcggtgcattacaccgtgctcacggtgctgatgcat
gaatcggttctccggcctgaagaccgcgcgtttcttgaaccctgggccgatttgtggcgc
atagaagcctcaggagctttcatgaccacatatcttgaagccgtgggcggcagcaggctg
gtgcccgaaaatgaacaaggcgttcaggtgctgctggaagcgtttttgctggaaaaagcg
tttatggagcttgatgcagaactgaaagcgccttccggcatggtgggactgccgctggct
gccattatcaccctgctgggagcagagggctga

DBGET integrated database retrieval system