KEGG   Deferribacter desulfuricans: DEFDS_0940Help
Entry
DEFDS_0940        CDS       T01188                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ddf  Deferribacter desulfuricans
Pathway
ddf00010  Glycolysis / Gluconeogenesis
ddf00030  Pentose phosphate pathway
ddf00051  Fructose and mannose metabolism
ddf00052  Galactose metabolism
ddf00680  Methane metabolism
ddf01100  Metabolic pathways
ddf01110  Biosynthesis of secondary metabolites
ddf01120  Microbial metabolism in diverse environments
ddf01130  Biosynthesis of antibiotics
ddf01200  Carbon metabolism
ddf01230  Biosynthesis of amino acids
ddf03018  RNA degradation
Module
ddf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEFDS_0940
   00030 Pentose phosphate pathway
    DEFDS_0940
   00051 Fructose and mannose metabolism
    DEFDS_0940
   00052 Galactose metabolism
    DEFDS_0940
  09102 Energy metabolism
   00680 Methane metabolism
    DEFDS_0940
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    DEFDS_0940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:ddf01009]
    DEFDS_0940
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:ddf03019]
    DEFDS_0940
Enzymes [BR:ddf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DEFDS_0940
Protein phosphatases and associated proteins [BR:ddf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DEFDS_0940
Messenger RNA biogenesis [BR:ddf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DEFDS_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Fer4_12
Motif
Other DBs
NCBI-ProteinID: BAI80412
UniProt: D3PCT9
LinkDB All DBs
Position
940676..941641
Genome map
AA seq 321 aa AA seqDB search
MKRIAVLTSGGDCPGMNAAIRSVVRTALSKGIEVYGIEQGYKGLIEGEFRKLESKDVANI
IQKGGTFLRSARSERFKTEEGQKEAIKNLEKHNIDGLVVIGGDGSLRGATVLCGKYGVNV
IGIPGSIDNDIYGTDMSIGVDTALNTIVRCIDSINDTASSHDRTFLIEVMGRNCGYLALM
SAIAGGAEAVLIPEVPYNIEKIIEKIKKRYEEGKTRSIVIVAEGVGSAYDFGKVFGMIGG
FETRITVLGHLQRGGSPTVFDRTLATRMGAFAVETLLDGTGCGKMVALQKTKMELVDLND
VLNKKKELDPKLLEIAEILSN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgctgtattaacaagtggtggtgattgtccaggtatgaatgcggctata
agaagtgttgtgcgtacggcattgagcaaaggtatagaagtgtatggtatagagcaaggg
tataagggtttaatagaaggagagtttagaaaacttgagagcaaggatgtcgcaaacatt
attcaaaaaggtgggacttttttaagaagtgccagaagtgaaagattcaaaaccgaagag
gggcaaaaggaagctattaaaaaccttgaaaaacataatattgatgggcttgtggttata
ggcggggatggttcccttagaggtgctactgtactttgtggtaaatatggtgtgaatgtg
attgggatacctggttccattgataatgatatatacggcactgatatgtctataggagtg
gatacagcgttaaatacgattgttcgttgtattgattctatcaatgatacagcaagttcc
catgatagaacatttcttattgaagtaatggggaggaactgtggttatttggctttaatg
tcagccattgctggtggagctgaagctgtattgattcctgaagtaccatataatattgag
aaaattattgaaaagattaaaaaaagatatgaagaagggaaaacgagaagtattgttatt
gtagcagaaggggtaggatctgcttatgattttgggaaggtttttggcatgattggtggt
tttgagacaagaattacagttttaggtcatttgcaacgaggtggtagtcctactgttttt
gatagaacgcttgcaacaaggatgggtgcatttgctgttgagactctcttggatgggaca
ggttgcggtaaaatggtagctttacagaaaactaagatggagcttgttgatttaaatgat
gttttgaataagaagaaagagcttgacccaaaattattagaaatagctgaaatattgagc
aattag

DBGET integrated database retrieval system