KEGG   Desulfitobacterium dehalogenans: Desde_0576
Entry
Desde_0576        CDS       T02146                                 

Definition
(GenBank) pyrrolysine biosynthesis protein PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh00300  Lysine biosynthesis
ddh01100  Metabolic pathways
ddh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ddh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Desde_0576
Enzymes [BR:ddh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Desde_0576
SSDB
Motif
Pfam: 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_7 Shikimate_DH 3HCDH_N TrkA_N DapB_N DUF1188
Other DBs
NCBI-ProteinID: AFL99029
UniProt: I4A4Z5
LinkDB
Position
598640..599488
AA seq 282 aa
MTRLSESDIRCIGNRMENYNRELVIKTGHTLSEIAAHAVGISQVNEGQIDNLGNIAVVPI
TSGLGVIRGFAETVSGILTFLGAKAQVMNHSDVQGVAEALERKSEMIFMADDDRFIAMHL
KSGYFSENSEATGKGYAAALDYMVNSLENRSVLIMGAGRVGRAAAFSVLNFKGKVHVFDL
ERKASETLAQEIYKKSGSRISIEENLIIALRGHQFIIDACSEGEFINKEHITPESYIAAP
GVPLGIHPEAIPGIKPRLIHDPLQLGVATMLFDMIKVSGIYS
NT seq 849 nt   +upstreamnt  +downstreamnt
atgacccgtctaagcgagagcgatatacgttgcattggcaacaggatggaaaattacaac
cgagaattagtcattaagaccggacataccctttctgaaatagcagcccatgctgtcggc
atttcccaggtgaacgaaggacaaattgataatttgggcaatattgcagttgtaccaata
acaagtggattaggggttattcgtggatttgcagaaaccgtttcaggaattttaactttt
ttaggagcgaaggcccaagttatgaatcactcagatgttcagggcgtcgctgaagcatta
gagcggaaatctgaaatgatttttatggcggatgatgatcgctttatcgctatgcattta
aaaagcggatatttctcggaaaatagtgaggcaactggaaaagggtatgccgctgcatta
gattatatggtcaatagccttgagaatcgcagcgttttaatcatgggtgcggggagggta
ggacgtgcggcagccttttctgttctcaattttaagggtaaggttcatgtatttgactta
gagcggaaagcaagtgaaactttggctcaagagatttataaaaagagtggaagccgaatc
agcattgaagaaaatctaataatagccttaagaggtcatcagtttattattgatgcatgt
tctgaaggcgaattcataaacaaggagcatataacaccagaaagttatattgctgcacca
ggagtgccattaggtattcatccggaagctattccagggattaagccgcggttaattcat
gatccccttcaattaggcgttgcgacgatgctttttgatatgataaaagtgagtgggatt
tactcctaa

DBGET integrated database retrieval system