KEGG   Desulfitobacterium dehalogenans: Desde_2520Help
Entry
Desde_2520        CDS       T02146                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddh01100  Metabolic pathways
ddh01110  Biosynthesis of secondary metabolites
ddh01130  Biosynthesis of antibiotics
ddh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desde_2520
Enzymes [BR:ddh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Desde_2520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AFM00850
UniProt: I4AA65
LinkDB All DBs
Position
2532613..2533470
Genome map
AA seq 285 aa AA seqDB search
MNIGYLGPKGSFSEEALQLFLTTQSDLLEPPLTLVPFTTIPKLLTACQDLEIEGAFVPLE
NSTEGQVGVTMDMLGQTESLYIMREFIFPVDQCLITAKPLDLGQIEQVFSHEQALGQCRD
FLEAHLPQAEQLPCPSTAEAVMKIANSPGKHWAALGPRRAAEIYNLHCEAERIQDSMLNA
TRFIFVGHHLAEMNEEDKTSLLVITGDTPGALASALQEFALRNINLSRIESRPSKKKLGE
YVFFVDIDGYVFSPSLQEALWALKDKGVSTKLLGSYPKAQPFAKE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaacattggctatctggggcctaagggcagtttttctgaggaagcacttcaactcttt
ctgactactcaatccgatctattggagccaccgctaacccttgtcccctttacgacaatt
cccaagctcttaacggcctgccaagacctcgagattgaaggagcctttgtccctctggaa
aattccaccgaaggtcaagtaggggtaaccatggatatgttaggtcagacggaaagtcta
tatatcatgagagaatttattttccctgtggatcaatgcctgattactgcgaagcccctt
gatttaggtcagatagagcaagtcttttcccatgagcaagccttaggacaatgccgagat
tttcttgaagctcatctgcctcaggcggagcaattaccctgtcccagtactgctgaagct
gttatgaaaatcgccaatagccccggtaagcattgggctgctctcggaccgcgccgggcc
gcagaaatctataatttacactgtgaagcggaaagaatccaggactccatgctcaatgcg
acccgtttcattttcgtaggtcatcatcttgcggaaatgaatgaggaggataaaacttca
cttttagtcattaccggagatacccccggagccttggccagtgcccttcaggaatttgcc
ctgaggaacattaacttgagccgtattgagtctcgcccctccaagaaaaaactgggagag
tatgtgttcttcgtggacattgatggatatgtcttctctccatctctccaagaggcttta
tgggctctcaaagacaaaggggtcagtactaaactcctgggatcctatcccaaagcacag
ccttttgcgaaggaataa

DBGET integrated database retrieval system