KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0267420Help
Entry
DDB_G0267420      CDS       T00245                                 

Gene name
sodA
Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DDB_G0267420 (sodA)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DDB_G0267420 (sodA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 8615933
NCBI-ProteinID: XP_647129
dictyBase: DDB_G0267420
UniProt: Q55GQ5
LinkDB All DBs
Position
1
AA seq 153 aa AA seqDB search
MSKTAVCVIKGEKVNGVVKFTQENKDSPVTVNYDITGLEKGEHGFHVHAFGDTTNGCVSA
GPHFNPFGKNHGAPSDEDRHVGDLGNIVADGESNTKGTISDKIISLFGEHTIVGRTMVVH
ADQDDLGKGGKPDSLTTGAAGARLGCGVIGVSQ
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaactgcagtttgtgtaattaaaggtgaaaaagttaacggtgttgttaaattc
actcaagaaaataaagactcaccagtcactgttaattatgatatcactggtttagaaaaa
ggtgaacacggtttccacgttcatgcttttggtgatacaaccaatggttgtgttagtgct
ggtccacattttaacccatttggtaaaaatcatggtgctccatcagatgaagatcgtcat
gttggtgatttaggtaacattgttgccgatggtgagtcaaataccaaaggtaccatcagt
gataaaattatctccctctttggtgaacacacaatcgttggtagaactatggttgtccat
gctgatcaagatgatttaggtaaaggtggtaaaccagattccttaactactggtgctgct
ggtgctcgtcttggttgtggtgtcattggtgtctctcaataa

DBGET integrated database retrieval system