KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0268132Help
Entry
DDB_G0268132      CDS       T00245                                 

Definition
(RefSeq) SET domain-containing protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    DDB_G0268132
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0268132
Enzymes [BR:ddi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     DDB_G0268132
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     DDB_G0268132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 8616388
NCBI-ProteinID: XP_647576
dictyBase: DDB_G0268132
UniProt: Q55FF7
LinkDB All DBs
Position
1
AA seq 898 aa AA seqDB search
MNKKVFLNNYLNERKQLNGNEINNNNNNNNNNNYNNNNNNNNLNKDKDKDKDKERDKDRE
RIKERTKERGDKERDRDKERDRERKKEKVEKPQVAVLKQSAQHVKQQRLKEKEKGKEKEK
DKEKDKEKDKEREREKEKEKEKVKDREKEKEKEKEKEKEKVKDREKVKDREKEKEKEKER
DKLKPKDSKIKERDIEKEKVRDREKEREKIRDREKDKNSNNNIIKPKEKKDESIAKTQKN
ITIKENGNITSSSSISNSSSINNNNNNKIINKSVSTNGNGNSSNSTNNNNSNGSNGVDIK
KKPILDSKKRALPSSSSKSQTTSTSTSTSTSKLSKPIVKKKKDSNLKRIKLSNGGVVTKY
KRKKSNNDSGSDDSSYDSSDDSSGNDSSSSGSSSSSGSDDSDNSSDDDSDSSDGDSSSDN
DDDNDKNSSGSDDDEDGDSSSFDSNYSGSYDSFSDSSECDDSDCSCGKKRKNKPDSSNSK
LTNLKKPITNGNTTDNLDNGLTTSSIVVDDQQKITNEYIEKHLNSGKANPDYSDIAVLIQ
KSRNKKFGFISRNFFIERTEKILYEIDDIDICNCSKSSGSVCGDDCLNRESYVECNIEHC
ELGKKCTNQRFQRKQYSNIKPAFTGKKGWGLIANEDIEEKQFIMEYCGEVISKQTCLRRM
KEAENEKFFYFLTLDSKECLDASKRGNLARFMNHSCDPNCETQKWTVGGEVKIGIFAIKP
IPKGTELTFDYNYERFGAQKQECYCGSVNCRGYLGQKSKSSTSTTRPKQITRWKNSIVLN
HNHHVKYFLGEPIIPHSNPSSSSSSRSVSTLYNSELSPEMELQLINSKRIFLHRNVRKLK
SFYFNVFNYYSSGGGSGGNNKKLINITSTSTSNSSLNSSLNSNIKLKRKNKISDIFNI
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaggtatttttaaataactatttaaatgaaagaaaacaattgaatggtaat
gaaatcaacaataacaacaataacaacaacaataacaattacaacaataataacaataat
aataatctaaataaggataaggataaagataaagataaagaaagagataaagatagagaa
agaattaaagaaagaactaaagaaagaggtgacaaagaaagagatagagataaagaaaga
gacagagagagaaagaaagaaaaagttgaaaaacctcaagttgccgtcttaaaacaaagt
gctcaacatgttaaacaacaaagattaaaagaaaaagaaaaaggtaaagaaaaggaaaaa
gataaagaaaaagataaggaaaaagataaagaaagagaaagagaaaaagaaaaagaaaaa
gaaaaggtaaaagatagagaaaaagaaaaagaaaaagaaaaagaaaaagaaaaagaaaag
gtaaaagatagagaaaaggtaaaagatagagaaaaggaaaaagaaaaagaaaaagaaaga
gacaagctcaaaccaaaagattccaaaattaaagaaagagatattgaaaaggaaaaagta
agagatagagaaaaagaaagagaaaaaattagagatagagaaaaagataaaaatagtaac
aataatattattaaaccaaaagaaaaaaaagatgaaagtattgcaaaaactcaaaaaaat
ataacaattaaagaaaatggcaatataaccagtagtagtagtattagtaatagtagtagt
attaataataataataataataaaataataaataagagtgttagtaccaatggtaatggt
aatagtagtaatagtacaaataataataacagtaatggtagtaatggtgtagatataaaa
aagaaaccaattcttgactcaaagaaaagggcattaccatcatcatcatcaaaatctcaa
actacatcaacttcaacttcaacctcaacttcaaaattatcaaaaccaattgtgaaaaag
aaaaaagattcaaatttaaaaaggattaaactttcaaatggtggtgtagttacaaaatat
aagagaaagaaatcaaataatgatagtggtagcgatgatagtagttatgatagtagtgat
gatagtagcggtaatgatagtagtagtagtggtagtagcagtagtagtggtagtgatgac
agcgataatagtagtgatgatgatagtgatagcagtgatggcgatagtagtagtgataac
gatgatgacaatgacaaaaatagtagtggaagtgatgatgacgaagatggtgattctagt
agtttcgatagtaattatagtggttcatatgatagttttagtgacagtagcgaatgtgac
gatagtgattgttcatgtggaaaaaaaagaaaaaataaacccgatagtagtaatagtaaa
ttaacaaatttaaaaaaaccaataaccaatggtaacaccaccgataatttagacaatggt
ttaacaacatcatcaatagtagttgacgatcaacaaaaaattacaaatgaatatattgaa
aaacatttaaattctggtaaagcgaaccctgactattctgatattgctgtcttaattcaa
aaatcaagaaataagaaatttggtttcatttcaagaaacttttttatagaaagaacagag
aaaatattatacgaaattgatgatattgatatttgtaattgttcaaaaagtagtggatca
gtttgcggtgatgattgtttaaatagagaatcatatgtagaatgtaatattgaacattgt
gaattaggtaaaaaatgtacgaatcaaagatttcaaagaaaacaatattcaaatattaaa
cctgcatttacaggtaaaaaaggatggggattaattgcaaatgaagacattgaagaaaaa
caatttataatggaatattgtggtgaagtaattagtaaacaaacttgtttgagaaggatg
aaagaggcagagaatgaaaagtttttttatttccttacattagattcaaaggaatgtttg
gatgcaagtaagaggggtaatttagcaagatttatgaatcatagttgtgatccaaattgt
gaaacccaaaaatggacggttggtggtgaagtaaagattggaattttcgcaattaaacca
ataccaaaaggtactgaattaacatttgattataattatgaaagatttggtgcacagaaa
caagaatgttattgtggttctgtaaattgtcgtggttatttaggtcagaaatcaaaatca
tccacttctacaactcgtccaaaacaaatcactcgttggaagaattcaatagttttaaat
cataatcatcatgttaaatattttttaggtgaaccaatcattccacattcaaacccttcc
tcctcctcttcctctagatcagtatcaactctttataatagtgaattatcaccagagatg
gaattacaattaattaattcaaaaagaatattcctacatagaaatgttagaaaattgaaa
tctttttattttaatgtttttaattattatagtagcggtggtggtagtggtggtaataat
aaaaagttaattaatataacttcaacttcaacttcaaattcatctttaaattcatcttta
aattcaaatataaaattaaaaagaaaaaataaaattagtgatatcttcaatatttga

DBGET integrated database retrieval system