KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269196Help
Entry
DDB_G0269196      CDS       T00245                                 

Gene name
tubB
Definition
(RefSeq) beta tubulin
  KO
K07375  tubulin beta
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    DDB_G0269196 (tubB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0269196 (tubB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ddi04812]
    DDB_G0269196 (tubB)
   04147 Exosome [BR:ddi04147]
    DDB_G0269196 (tubB)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     DDB_G0269196 (tubB)
Cytoskeleton proteins [BR:ddi04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    DDB_G0269196 (tubB)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0269196 (tubB)
  Exosomal proteins of colorectal cancer cells
   DDB_G0269196 (tubB)
  Exosomal proteins of bladder cancer cells
   DDB_G0269196 (tubB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 8617114
NCBI-ProteinID: XP_646162
dictyBase: DDB_G0269196
UniProt: P32256
LinkDB All DBs
Position
1
AA seq 455 aa AA seqDB search
MREIVQIQAGQCGNQIGSKFWEVISEEHGIQSDGFHAGGEDEHLKRLQLERINVYYNEAR
DGKYVPRSVLVDLEPGTVDTIKASPYGKLFRPDNFIHGQSGAGNNWAKGHYTEGVELVES
VLDVVRRETEGCDCLQGFQVTHSIGGGTGSGLGTLLISKIREEFPDRMMCTFSVVPSPKV
SLTVVEPYNATLSVHQLVENADEVMCIDNEALHDICFRTLKLTQPNYGDLNHLISSVMSG
ITCCLRFPGQLNSDLRKLAVNLIPFPRLHFFLVGFAPLTAKGASSYNRITVPELTQQMFD
AKNMMAASDPHNGKYLTASALFRGKIFTKEVDEQMHNIQTKNSSYFVEWIPHNIKSSICD
IPPKGTPMAVTFIGNNTAIQDLFKRISIHFQAMFRRKAFLHWYTLEGMEELEFTEAESNM
NDLVYEYQQYSNQETEEDGGEYQEEHEEHEEQAEN
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaattgtacaaattcaagcaggtcaatgtggtaatcaaattggttccaaattt
tgggaagtaatttctgaagaacacggtatccaaagcgatggtttccacgctggtggtgaa
gacgaacatttaaaacgtctccaattagaaagaattaatgtatactacaatgaagctaga
gatggtaaatacgttccaagatctgtacttgtcgatcttgaaccaggtacagttgatacc
atcaaagccagtccatatggtaaattattcagaccagataatttcatccatggtcaatct
ggtgcaggtaataattgggctaaaggtcattatactgaaggtgttgaattagttgaatca
gtacttgatgttgtacgtagagaaacagaaggttgtgattgtttacaaggtttccaagtc
acccattcaattggtggtggtacaggttcaggtttaggtactttattgattagtaagatt
cgtgaagaattcccagatcgtatgatgtgtacattttcagttgtaccatcaccaaaggta
tcattaacagtcgtagaaccatacaatgctaccctctctgtccatcaattggttgaaaat
gccgatgaggttatgtgtattgataatgaagcactccacgatatttgcttccgtacactc
aaactcacccaaccaaactatggtgatttaaatcatctcatctcatcagttatgtctggt
atcacctgttgtcttcgtttcccaggtcaattgaactctgatcttcgtaaattagctgta
aatttaattccattcccacgtcttcacttctttttggttggtttcgctccactcactgcc
aaaggtgcctcgtcatacaatcgtatcaccgtaccagaactcacccaacaaatgtttgat
gccaagaatatgatggctgcttccgatccacacaatggtaaatacttgactgcctctgct
ctctttagaggtaaaatcttcaccaaggaagtcgatgaacaaatgcacaacattcaaacc
aaaaatagcagttactttgtcgaatggattccacacaacattaaatcctccatttgtgat
atcccaccaaaaggtaccccaatggccgtcaccttcatcggtaacaacactgccatccaa
gatctcttcaaacgtatctcaattcacttccaagctatgttccgtagaaaggctttcctt
cattggtacaccctcgaaggtatggaagaattggaatttactgaagctgaatcaaacatg
aacgatttagtttacgaatatcaacaatattctaaccaagaaactgaagaagatggtggt
gaatatcaagaagaacatgaagaacatgaagaacaagctgaaaattaa

DBGET integrated database retrieval system