KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269242
Entry
DDB_G0269242      CDS       T00245                                 
Symbol
fcsA
Name
(RefSeq) fatty acyl-CoA synthetase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00061  Fatty acid biosynthesis
ddi00071  Fatty acid degradation
ddi01100  Metabolic pathways
ddi01212  Fatty acid metabolism
ddi04146  Peroxisome
Module
ddi_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DDB_G0269242 (fcsA)
   00071 Fatty acid degradation
    DDB_G0269242 (fcsA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DDB_G0269242 (fcsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddi01004]
    DDB_G0269242 (fcsA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0269242 (fcsA)
Enzymes [BR:ddi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     DDB_G0269242 (fcsA)
Lipid biosynthesis proteins [BR:ddi01004]
 Acyl-CoA ligase
  Long/very long chain acyl-CoA ligase
   DDB_G0269242 (fcsA)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   DDB_G0269242 (fcsA)
  Exosomal proteins of breast cancer cells
   DDB_G0269242 (fcsA)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C Peptidase_C101
Other DBs
NCBI-GeneID: 8617013
NCBI-ProteinID: XP_646065
dictyBase: DDB_G0269242
UniProt: Q55DR6
LinkDB
Position
1:complement(2990411..2993319)
AA seq 667 aa
MSSLSTKTDLLGDPDFIRLQSVEVDGSEVIPGETRPRRNTKFPKLTNSPDGKTFTLYDVY
RINKDSDSNFLGIRELLADGKRGDYKWISYKQACIRANNIGSALVQLGLNKGDRIGIFSI
NRPEWVLSDMAAMNHSLVPVALYATLGANAIEYVVNHSEISVLLCEGKNVEKILSMPGTT
IKTIVSYDPLPQATLDKFKDNENVKLYLLSDFEKLGEQNPAQHEVPSPEDLCTLLYTSGS
TGNPKGVMLTHTNMVSEVAGANFSPAGVIPEDVHMSYLPLAHSFERAVVSLMCYVGGQIG
FFSGLIPELFNDIQVLRPTFLCGAPRVWQRLHDKLWFTVNNDSWLKKFLFNWGLNSKQSA
LRLGSTTPIWDKLVFSKTKDRLGGRVKFILSGSAPLDPKLAEFLRACFCCPVVSGYGLSE
NVGGASVAYPEDNNVGHVGPPLSACEMKLIDVPEMNYFSTDKPCPRGEVCIRGFNVFKGY
FKDPEKTKEDLKEDGWFHTGDIGRWNENGTLSIIDRKKNIFKLSQGEYVAAEYLESVFVR
SPFASQVFVYGDSLNSFLVGVVVPDFEVVQKLFASKYPELDVSNHATLAKSKELYKEILS
SFDACAAEAKLHGFEKLKHIYVEHEPFTEENNLLTPSFKPKRPQLKERYQTIIDTLYAEY
KRDHPDV
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgtcaagcctttcaacaaaaacagatttacttggtgacccagattttatccgtcttcaa
agtgttgaagtagacggtagtgaagttataccaggcgaaactagaccaagaagaaacact
aaattcccaaaattaacaaattcaccagacggtaaaacctttaccttgtatgatgtttat
agaataaataaagattcagattcaaactttttaggtattcgtgaattattagcagatggc
aaaagaggtgattacaaatggatttcttataaacaagcatgcattagagcaaataacatt
ggttcagctttagttcaattaggtttaaataagggtgatagaattggtattttttcaatt
aatagaccagaatgggttttatcagatatggcagcaatgaatcattcacttgtaccagtt
gcattatatgcaacattaggtgccaatgcaattgaatatgttgttaatcattcagagatt
tcagtacttttatgtgaaggtaaaaatgttgaaaagattctttcaatgccaggtacaacc
attaaaacaattgtcagttatgatccattaccacaagcaacattagataaattcaaggat
aatgaaaacgttaaactttacctcttatcagattttgaaaaattgggtgaacaaaatcca
gcccaacatgaagtcccatcaccagaagatttatgtacattactttacacctctggttca
actggtaatccaaagggtgtaatgttaactcatacaaatatggtcagtgaagttgcaggt
gccaacttttcaccagcaggtgtaattccagaggatgttcatatgtcatacctcccattg
gctcactcatttgaacgtgccgtcgtttcattgatgtgttatgttggtggtcaaattggt
ttcttctctggtttaattccagagttattcaacgatatccaagttttacgtccaaccttt
ttatgtggtgccccaagagtatggcaacgtcttcacgacaaactttggttcactgtcaac
aatgatagttggttaaagaaattcctcttcaattggggtctcaactctaaacaatctgca
ttaagacttggttcaaccactccaatttgggataaattggttttctcaaaaacaaaggat
agacttggtggtcgtgttaaattcatcctttccggttccgctccattggatccaaaatta
gccgaattcttacgtgcttgtttctgttgtccagtcgtctctggttatggtctctctgaa
aatgtaggtggtgcctctgttgcctatccagaagataacaatgtaggtcatgttggtcca
ccactcagtgcctgtgaaatgaaattaatcgacgttccagagatgaactatttctctact
gataaaccatgtccaagaggtgaggtttgtattcgtggtttcaacgttttcaaaggttac
tttaaggatccagaaaagaccaaagaagatctcaaagaagatggttggttccatactggt
gatattggtcgttggaatgaaaatggtaccctctcaatcattgatcgtaagaaaaatatc
ttcaaattatctcaaggtgaatacgttgccgccgaatatttggaatctgttttcgttcgt
tcaccatttgcctctcaagtatttgtctatggtgattcattaaatagtttcttggttggt
gttgtcgtaccagattttgaagttgtccaaaaattattcgcttccaaatatccagaactt
gatgtttcaaaccatgcaaccctcgcaaaatcaaaagaactctacaaagaaattttatca
agtttcgatgcttgcgctgccgaagccaaattacatggttttgaaaaattaaaacatatc
tacgtagaacatgaaccattcactgaggaaaacaatttattaactccatcattcaaacca
aagagaccacaactcaaagaaagatatcaaaccattattgataccctttatgctgaatac
aaacgtgatcatccagacgtataa

DBGET integrated database retrieval system