KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269602Help
Entry
DDB_G0269602      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K15276  solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ddi02000]
    DDB_G0269602
Transporters [BR:ddi02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   DDB_G0269602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UAA EamA
Motif
Other DBs
NCBI-GeneID: 8617056
NCBI-ProteinID: XP_646106
dictyBase: DDB_G0269602
UniProt: Q55DM5
LinkDB All DBs
Position
1
AA seq 359 aa AA seqDB search
MGSGIEVNDSSTTNSNNNEKVQLSYNMKLALATGGIMGSFLLYGILQERLMVVPYKNADG
SEEYFTDSTFLVLSNRVFAALMAIVIVLKRGESLKNVAPLHKYVGVALSNFCATWCQYEA
LKYVNFPTQTLGKCGKMLPVMLVGTFISGKKYGLKDYSIALTITTGCMIFFLTGKISNNE
SSNTSYGIILMALYMFFDSFTSTFQEKMFKGYTMSTYDQMIYVNGCSSIISVFILILNGR
LFPAIEFISTHNGVFFDSTMLSASAGLGQMVIYYTIKEFGALVFSTIMVTRQMVSIILST
LIYLHPLSNTQWIGALLVFGTLYYKSIEDSKKKHGGHSHGGSNAATTTTPSNNSNNTEK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgggaatagaggtaaatgattcatcaacaaccaatagtaataataatgaaaaa
gttcaattaagttataatatgaaattagcattagcaacaggaggtattatgggatcattt
ttattatatggtatccttcaagaacgtttaatggtggtaccatataagaatgccgatgga
agtgaagaatatttcactgatagtacattccttgttttatcaaatcgtgttttcgcagca
ttaatggcaattgttatcgttttaaaaagaggtgaatccttaaagaacgttgccccactt
cacaaatatgtaggtgttgcactttcaaacttttgtgcaacatggtgtcagtatgaagca
ctcaaatatgtaaatttcccaactcaaactttaggtaaatgtggtaaaatgttaccagtt
atgctcgttggtacctttattagtggtaaaaaatatggtttaaaagattattcaattgct
ttaacaattacaactggttgtatgattttctttttaactggtaaaatttcaaataatgaa
agttcaaatacttcatatggtatcattttaatggcattatatatgtttttcgatagtttt
acaagtactttccaagaaaagatgtttaaaggttatactatgagtacttatgatcaaatg
atttatgttaatggatgttcatcaataatttcagtatttattttaattttaaatggaaga
ttattcccagcaatagaatttatttcaacacataatggtgtatttttcgattcaacaatg
ttatcagcatctgcaggtttaggtcaaatggtaatttattacacaatcaaagaatttgga
gcattggttttctcaaccattatggttacaagacaaatggtatcaatcattctttcaaca
cttatttatcttcatccattatcaaatactcaatggattggtgcccttttagtatttggt
accttatattataaatcaattgaagatagtaaaaagaaacatggtggtcatagtcatggt
ggtagtaacgcagctacaactacaactccatctaataatagtaataataccgaaaaataa

DBGET integrated database retrieval system