KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269790Help
Entry
DDB_G0269790      CDS       T00245                                 

Gene name
gaa
Definition
(RefSeq) alpha-glucoside hydrolase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00052  Galactose metabolism
ddi00500  Starch and sucrose metabolism
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    DDB_G0269790 (gaa)
   00500 Starch and sucrose metabolism
    DDB_G0269790 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0269790 (gaa)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     DDB_G0269790 (gaa)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0269790 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 8617236
NCBI-ProteinID: XP_646281
dictyBase: DDB_G0269790
UniProt: Q55D50
LinkDB All DBs
Position
1
AA seq 867 aa AA seqDB search
MKLLSSLIIFFVIVLFCVVGSLSASLCKYPGYSTQGVTKTNNGYEATLNLISAGPYGNDI
EQLNFQLTFETSQIFRVRITDPNNQRWEVPPTVNQLVGENPDSTDYIIEFTNNPFGFAAT
RISTGEVLFNTTQPSDCSFNGLIYSNYYLELSTSFTESNPNIYGLGERTSQLRLFNNFTY
TLFAKDQGTASIPNINLYGSHPFYLQLSSSSGNANGVFLLNSNAMDVQLQPNSLTYKVVG
GIFDLFFFTGPTPLSVIQQYSQVIGTTHMPSYWSLGYHNCRWGYHSIAETAQVVANYSKY
NIPLETMWNDIDYMDSFRDFTTDPVNFAASDYKTFIDGLHANNQHYIMIVDPGISNIEPI
YQSHIDLMESGAYIKAGGTDGEPLVGSVWPGYVNFPDFLHPNGTEFWTQQFQRFYETVQF
DGVWIDMNEISNFCDGNCFNNTDTPMPPPQFDPNYPPYIPGGVPLYSKTINMTSLQYNNT
LVYNSHSLYGYTEGLATQLAVQSILGTRSTIISRSTFPGTGAHFAHWLGDNKSTFTDMYY
SIPGMLAMNMFGIPMVGADICGFNGDSNAELCGRWLQLGCFYPFTRNHNTFLGAPQEPWV
FGQEVVDISIKAINGKLTLLPFYYTLFHISHVSGDPVVRPLFFEYPSDPNTFAIDQQFLV
GTGLMVSPVLTQGATTVNAYFPNDIWYEYGNGSLVQSVGTHQTLNAPFDVINVHMRGGNI
IPTQPTSSYVTPVDGIPITTKISRTLPFELIIALDSSLQATGQLFLDDGESIQTYVDNKY
SFIQFDVVSSPSSSAYKLQSTILNNNYNGTASLIINSIQIYGSPSVQQVIVNGSPINSFN
AVSDSTLSVSNLQLALDESFEVDFVLY
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttttgtcttcattaattattttttttgttattgtattattttgtgttgttgga
tcattatcagcatcattatgtaaatatccaggttattcaactcaaggtgttacaaaaaca
aataatggttatgaggcaacacttaaccttatttcagcaggtccatatggtaacgatata
gaacaattaaattttcaattaacttttgaaactagtcaaatttttagagttagaattact
gacccaaataatcaaagatgggaagtcccaccaactgttaatcaattagttggagaaaat
ccagattcaactgattatataattgaatttacaaataatccatttggttttgcagcaact
cgtatttcaactggtgaagttttatttaatacaactcaaccaagtgattgttcatttaat
ggtttaatttattcaaattattatttagaattaagtacatcattcacagagagtaatcca
aatatttatggtttaggagaacgtacaagtcaattaagattatttaataattttacatat
actttatttgcaaaagatcaaggtacagcaagtataccaaatattaatttatatggttca
catccattttatttacaactttcatcaagttcaggtaatgcaaatggtgtatttctattg
aactccaatgcaatggatgttcaattacaaccaaattcattaacatataaagttgttggt
ggtattttcgatttattctttttcacaggaccaacaccattatcagtgattcaacaatat
tcccaagtcattggtacaactcatatgccatcctattggtcactcggatatcataattgt
agatggggttatcattcaattgcagagactgctcaagtggttgcaaactattcaaaatat
aatattccattagagaccatgtggaatgatatcgattatatggatagctttagagatttc
acaactgatccagttaatttcgccgcttcagattataagacattcatcgatggtcttcat
gcaaataatcaacattatattatgattgttgatcctggtatttcaaatattgaaccaatc
tatcaaagtcacattgatttaatggaatctggtgcctacattaaagctggtggtacagat
ggtgaaccattggttggttcagtttggccaggttatgttaatttcccagatttccttcat
ccaaatggtaccgaattttggactcaacaatttcaacgtttctatgaaaccgttcaattc
gatggtgtttggatcgatatgaatgagatttcaaacttttgtgatggtaattgtttcaac
aatactgatactccaatgccaccaccacaatttgatccaaactatccaccatacattcca
ggtggtgtaccattatattcaaaaaccatcaatatgacctctcttcaatataataatacc
ttggtttataattcacacagtctctatggttacactgaaggtttagcaactcaattagca
gttcaatccattttaggtacccgttcaaccattatttcaagaagtactttcccaggtact
ggtgctcattttgcccattggttaggtgataataaaagtacttttaccgatatgtattac
tcgattccaggtatgttagcaatgaatatgtttggtattccaatggttggtgctgatatt
tgtggtttcaatggtgattcaaatgctgaactctgtggtagatggcttcaattgggttgt
ttctatccattcactcgtaatcataatacatttttaggtgcaccacaagagccttgggta
tttggtcaagaggttgtcgatatttcaatcaaagcaatcaatggtaaattaactttgtta
ccattctattacacattgttccatatttctcatgtttctggtgatccagttgttagacca
ttattctttgaatatccatcagatccaaatacttttgcaattgatcaacaatttttagtt
ggtacaggtttaatggtatcaccagttctcactcaaggtgctaccacagtgaatgcttac
ttcccaaatgatatctggtatgaatatggtaatggttcattggttcaatcagttggtacc
catcaaactttaaatgctccattcgatgtaatcaacgttcatatgcgtggtggtaatatc
attccaactcaaccaacctcctcatatgttacaccagttgatggtattccaattaccact
aaaatctctagaactttaccatttgaattgattattgccttggattcttcattacaagca
actggtcaattattcttggatgatggtgaatcaattcaaacctatgttgataataaatac
tctttcattcaattcgatgttgtctcctcaccatcttcatctgcctacaaattacaatca
accattctcaataacaattataatggtaccgcttctttaatcattaattctatccaaatc
tacggttcgccatcagttcaacaagtcattgttaatggtagcccaatcaattcatttaat
gctgtttctgattcaactctctctgtttcaaatttacaacttgctttagatgaatccttt
gaagttgattttgtattatattaa

DBGET integrated database retrieval system