KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0272216
Entry
DDB_G0272216      CDS       T00245                                 
Symbol
aslF
Name
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C Secretin_N_2 DUF1635
Other DBs
NCBI-GeneID: 8618454
NCBI-ProteinID: XP_645288
dictyBase: DDB_G0272216
UniProt: Q75JX7
LinkDB
Position
2:complement(1682586..1684744)
AA seq 681 aa
MFKLSDPFDYENDYNYSQINPISFWDEVAKKYVHWDKMYDKIYSSDGMYPDWFKGGELNT
CYNVLDKNVKNPVKRDQNALIYECPFIKKTIKLTYFQLYEKVCEFSRVLLNLNISKNDTV
LIFMANTLEPIIALLSCARIGATFSTLFDGYPVRSLIDRIDKLTPKLIITSNYGILNDEI
ITFTPNLKDAIQLSTFKPNHVITHFRNNEDIESNDSSIETIPIIPNTLDWDKEIQKIKDN
NQKPFYEYVPVESNHPLSIYFSSGTTGNCKAIVRSNGGNLVGLVYSWFSCISKKDETVYF
SHSSIGWISFHLGLFGSLVLGNTMVMFEGDIMKPIHYEHYLWETVEKHKINTFLTSPKTI
RFLIKNDPDANKIKSKYDLSSLVSIWTSGEVIEQSIPEYIESKIKCRSSNLYGQTESGCA
LLFDYKRINSKQFKTLFKPTPFLKPLIFSEDGIELPENQVGEVAFKLPLPPSFATTFYKN
ELLYKKMFNKFPGYYNSGDLGFKNENDYYGIVSRADDQIKIGGFDVLLNDIETSILKHPL
VLECCSIGIYHQDLANVPIGLLVLNQQQPDNSPSSSSSSSSSSSSSSSSSSSSSSSSSSS
SSALSLSLIDIKNQINEIIENDIGFYSELTKIIFVPQLPKTKTGKIPRQIISKFLNEPNY
QLKDSTCDREVFYSIKELYEK
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgtttaaattaagtgaccctttcgattatgaaaatgattataattactctcaaataaat
ccaatttcattttgggacgaagttgcaaaaaaatatgttcactgggataaaatgtatgat
aagatttatagtagtgatggaatgtatccagattggtttaaaggtggagaattaaataca
tgttataatgttttagataaaaatgttaaaaatcctgtaaaaagagatcaaaatgcatta
atttatgaatgtccatttataaagaaaacaattaaattaacatattttcaattatacgaa
aaagtatgtgaattttcaagagtacttttaaatttaaatatatcaaaaaatgatactgtt
ttaatatttatggcaaatacattagaaccaataattgcattgttatcatgtgctcgtatt
ggtgcaacattttcaactttattcgatggttatccagttagaagtttaattgatagaatt
gataaattgacaccaaaactaattataacatcaaattatggaattttaaatgatgaaatt
atcacatttacaccaaatttaaaagatgcaatccaattatcaacttttaaaccaaatcat
gttattactcattttagaaataatgaagatattgaatccaatgatagtagtatagaaacc
ataccaatcataccaaatacattagattgggacaaagaaattcaaaaaataaaagacaac
aatcaaaaaccattctatgaatatgtaccagtagaatcaaatcacccattaagtatttat
ttttcaagtggtacaactggtaattgtaaagcaattgtaagaagtaatggtggtaattta
gttggactggtttatagttggtttagttgtatttctaaaaaagatgaaacagtttacttt
tcacattcaagtattggatggatttcatttcatttgggattatttggatcattagtactt
ggaaatacaatggtgatgtttgaaggcgacattatgaaaccaattcattatgaacattat
ttatgggaaactgttgaaaaacataaaatcaatacatttttaacatcaccaaaaacaata
agattccttataaagaatgatccagatgctaataaaattaagtcaaaatatgatttatca
agtttagtttcaatttggacatctggcgaagttattgaacaatcaattcctgaatatatt
gaaagtaaaataaaatgtcgttcatcaaatttatacggtcaaactgaaagtggttgtgcc
cttttatttgactataaaagaataaatagtaaacagtttaaaacactatttaaaccaaca
ccatttttaaaaccattaatattttcagaggatggtattgaattaccagagaaccaagtt
ggtgaagttgcattcaaattaccattaccaccaagttttgcaacaacattttataaaaat
gaattactttataaaaagatgttcaataaatttccaggttattataatagtggtgattta
ggttttaaaaatgaaaatgattattatggtatagtttcaagagcagatgatcaaattaaa
attggtggttttgatgttctattaaacgatattgaaacatcaattttaaaacatccatta
gttttagaatgttgttcaattggtatttatcatcaagatttagccaatgttccaattgga
ttattagttttaaatcaacaacaaccagataattcaccatcatcatcatcatcatcatca
tcatcatcatcatcatcatcatcatcatcatcatcatcatcatcatcatcatcatcatca
tcatcagcattatcattatctttaattgatataaaaaatcaaattaatgaaattattgaa
aatgatattggtttttattcagaattaacaaaaatcatatttgttccacaattaccaaaa
acaaaaactggtaaaattcctagacaaatcatttcaaaatttttaaatgaaccaaactat
caattaaaagatagtacatgtgatcgtgaagttttttactccattaaagagttatatgaa
aaatga

DBGET integrated database retrieval system