KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273365
Entry
DDB_G0273365      CDS       T00245                                 
Symbol
aslL-1
Name
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Other DBs
NCBI-GeneID: 8618892
NCBI-ProteinID: XP_644790
dictyBase: DDB_G0273365
UniProt: Q557A9
LinkDB
Position
2:2750963..2752978
AA seq 644 aa
MYKLSDPFDYLNDNSYSNSNPEAFWDEVAKKNVFWEKMYDKVYSGDEIYPDWFKGGELNT
CYNLLDIHIKNPAKRDQDALIYECPYLKKTIKLTYYQLYEKVCKFSRVLLNLNVSKNDNV
LIFMANTLEPLIAMLSCARIGATQCTLFDGYSVKSLIDRIETITPKLIITTNYGIFNDEI
ITFTPNLKEAIELSTFKPSNVITLFRNEVLDETKLKKVQNIPTIPNTLSWYDEIKKLKEN
NQSPFYEYVPVESSHPLYILYTSGTTGNTKAVVRSNGPHMVGIKYYTFRKESDIPQIVFS
NANIGWVSFHGFFYGLLSGGNTLVMYEGGIIKNEHIEDDLWIAIVKHKVTHTFPSPSVFR
YLIKTDPEGTIVRSKYDLSNLKEIWCGGEVIEESIPEYIEQKLKIKCLRVYGQSEIGVTS
FISVHALNIPYRATGVPSIYIRPSILSEEGEVLNSNEIGLVAFKLPMPPSFAITFYKNDE
KFKQLFTRFPGYYDSGDLGYIDQRGFYTIVSRSDDQIKISCNKIQLNTIDTSILKHPSVL
ECCSIGILSPDCRTAPIGILVLKENPSIDLNKLQNEINNIITQDIESLAVLKKIIVINQL
PKTKVGKIPRQILSNLLNDPNYQLPDDVNDSELFYKIKELYMKN
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgtataaacttagtgatccttttgattatttaaatgataacagttattcaaattctaat
ccagaagctttttgggatgaggttgctaaaaagaatgttttttgggaaaaaatgtatgat
aaagtttatagtggcgatgaaatatatccagattggtttaaaggtggtgaattaaataca
tgttataatttattagacattcatattaaaaatcctgctaaaagagatcaagatgcatta
atttatgaatgtccatatttaaagaaaacaattaaattaacctattatcaattatatgaa
aaagtatgtaaattttcaagagttcttttaaacttaaatgtttcaaaaaatgataatgtt
ttaatatttatggcaaatacattagaaccattaattgcaatgttatcatgtgctcgtatt
ggtgcaactcaatgtacattattcgatggttattcggttaaaagtttaatagatagaatc
gaaacaattacaccaaaattaataattacaacaaattatggtatttttaatgacgaaatc
attacatttacaccaaatttaaaagaagcaattgaattatcaacttttaaaccaagtaat
gtaattactctatttagaaatgaagttttggatgaaacaaaattaaaaaaagttcaaaat
attccaactattccaaatacattaagttggtatgatgaaattaaaaaattaaaagaaaat
aatcaatcaccattttatgaatatgtaccagtagaatcaagtcatccattatatatactt
tatacaagtggcacaactggtaataccaaagctgttgtaagaagtaatggtccgcatatg
gttggtattaaatactatacattccgtaaagaatcagatatacctcaaattgtattttca
aatgcaaatattgggtgggtatcatttcatggtttcttttatggtttattatctggagga
aacaccttggtaatgtatgaaggtggtattataaaaaacgaacatatagaagatgattta
tggatagctattgtaaaacataaagtaacacatacatttccatccccatctgtatttaga
taccttattaaaactgatcctgaaggaacaattgtacgttctaagtatgatttatcaaat
ttaaaagaaatatggtgtggcggtgaagtaattgaagaatcaattccagaatacattgaa
caaaagttaaaaataaaatgtttaagagtatacggtcaaagtgaaattggcgtaacttca
tttattagtgtccatgctttaaatattccttatagagccactggcgtaccatcaatttat
attagaccatcaatactttcagaagaaggtgaagttttgaattcaaatgaaattggttta
gttgcatttaaactaccaatgccacccagttttgcaattacattttataaaaatgatgaa
aagtttaaacaactatttacaaggtttccaggttactatgattcaggtgatttaggttat
atagatcaaagaggattttatacaattgtttcaagatcagatgatcaaattaagataagt
tgtaataaaattcaattaaatacaattgacacatcaattttaaaacatccatcagtttta
gaatgttgttctattggtattttaagtccagattgtcgtactgcaccgattggtatattg
gtattaaaagaaaatccatcaattgatttaaataaattacaaaatgaaattaataatatc
atcacgcaagatattgaatcactggcagtcttaaaaaaaataatagttattaaccaatta
ccaaaaacaaaagttggtaaaattccaagacaaattttatcaaatttattaaatgatcca
aactatcaattaccagacgatgtcaatgactctgaactattttataaaatcaaagagtta
tatatgaaaaattaa

DBGET integrated database retrieval system