KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273697
Entry
DDB_G0273697      CDS       T00245                                 
Symbol
aslC-2
Name
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C Nlig-Ia DUF547
Other DBs
NCBI-GeneID: 8619090
NCBI-ProteinID: XP_644465
dictyBase: DDB_G0273697
UniProt: Q557A4
LinkDB
Position
2:complement(3293184..3295234)
AA seq 655 aa
MYRLSEPFDYLNDKTYANNEPEAFWDEVAKKLIKWDKMYDKVYSGDEMYPDWFKGGELNT
CYNVLDRQVQNPLKRDQDALIYECPYLKKTVKLTYYQLYEKVCEFSRVLLNLNISKNDNV
LIYMANTLEPLIAMLSCARIGATHCTIFDGYSVKSLIDRIETITPKLIITTNYGILNDEI
ITFTPNLKDAIEQSTFKPSNVITLFRNDITSESDLKKVKDIPTIPNTLSWYDEIKKFKEN
NQSPFYEYVPVESSHPLYIIYTSGTTGNSKAVVRSNGSHMVCLNYFNRYISENNQSTTLL
TTSSVGWVSFHGFLYGMLSFGSTFVMYEGGIIKNKHIEVDLWNTIEKHKVTHALSLASAI
RYLIKTDPEGTILRSKYDLSNLKEIWIGGEPIEESISEYIEQKLKIKSTRGYGQTEIGIT
YLYCFGHINIPYYATGLPSIFIRPSIFSDDGKELGVNEIGEIAFKLPMPPSFATTFYKND
EKFKQLFSKFPGYYNPGDLGFKDENGFYTIVSRSDDQIKISGNKVQLNTIETSILKHPSV
LECCSIGINDPTCYSVPIALLVLKQQQQQQQDQSTRQIDLNKLHSEINNIITQDIASLAV
LRKIVIVNQLPKTKTGKIPRPIISKFLNDSNFLLPDNISNVEIFYEIKELYTKIN
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgtatagactaagcgaaccatttgattatttaaatgataaaacttatgcaaataatgag
ccagaagctttttgggatgaagttgcaaagaaattaattaaatgggataaaatgtatgat
aaagtttatagtggtgatgaaatgtatccagattggtttaaaggtggtgaattaaataca
tgttataatgttttagatagacaagttcaaaatccattaaaaagagatcaagatgcttta
atttatgaatgtccatatttaaagaaaactgttaaattaacatattatcaattatatgaa
aaagtatgtgaattttcaagagtacttttaaatttaaatatttcaaaaaatgataatgtt
ttaatttatatggcaaatacattggagcctttaattgcaatgttatcatgtgctcgtatt
ggtgcaactcattgcacaatattcgatggttattcggttaaaagtttaatagatagaatt
gaaacaattacaccaaaattaataattacaacaaactatggtatattaaatgatgaaatc
attacatttacaccaaatttaaaagatgcaattgaacaatcaacttttaaaccaagtaat
gtaattactttatttagaaatgatattacaagcgaatcagatttaaagaaagtaaaagat
ataccaacgataccaaatacattaagttggtatgatgaaattaaaaaattcaaggaaaat
aatcaatcaccattttatgaatatgttccagtagaatcaagtcatccattatacataata
tatacaagtggtacaactggaaattctaaagcagttgtaagaagtaatggttcacatatg
gtttgtttgaattactttaaccgatatatttcagaaaataatcaaagtacaacattattg
acaacttcaagtgttggatgggtatcatttcatggtttcctatatggtatgttgtcattt
ggatctacatttgtaatgtatgaaggtggtattataaaaaataaacatattgaagttgac
ctttggaataccattgaaaaacataaagtaacacatgcattatcattggcaagcgctatt
agataccttattaaaactgatcctgaaggaacaatccttcgttcaaagtatgatttatca
aatttaaaagaaatatggattggtggtgaaccaattgaagaatcaatttcagaatacatt
gaacaaaagttaaaaataaaatcaacaaggggatatggtcaaactgaaattggtataact
tatttatattgttttggtcatattaatatcccatactacgcaactggtttaccatcaatt
ttcattagaccatcaatattttcagacgatggtaaagaattaggtgttaacgaaattggt
gaaatcgcattcaaattaccaatgccaccaagttttgcaactacattttataaaaatgat
gaaaagtttaaacaattattttcaaaatttccaggttactacaatcctggtgatttaggt
tttaaagatgaaaatggattttatacaattgtttcaagatcagatgatcaaattaaaatc
agtggtaataaagttcaattaaatacaattgaaacatcaatactaaaacatccatcagtt
ttagaatgttgttcaattggtattaacgatccaacttgttatagtgtaccaatagcctta
ttagttttaaaacaacaacaacaacagcaacaagatcagtcaactcgacaaatagattta
aataaattacactctgaaattaataatatcattacacaagatattgcatcattagcagtc
ttaagaaaaattgtaattgttaatcaattaccaaaaacaaaaactggtaaaattccaaga
ccaattatatcaaagtttttaaatgattcaaattttctattacccgataacatcagtaat
gttgaaatattttatgaaatcaaagaattatatacgaaaattaattag

DBGET integrated database retrieval system