KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0274493Help
Entry
DDB_G0274493      CDS       T00245                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03410  Base excision repair
ddi03420  Nucleotide excision repair
ddi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0274493 (lig1)
   03410 Base excision repair
    DDB_G0274493 (lig1)
   03420 Nucleotide excision repair
    DDB_G0274493 (lig1)
   03430 Mismatch repair
    DDB_G0274493 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0274493 (lig1)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0274493 (lig1)
Enzymes [BR:ddi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DDB_G0274493 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     DDB_G0274493 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     DDB_G0274493 (lig1)
DNA replication proteins [BR:ddi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    DDB_G0274493 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     DDB_G0274493 (lig1)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DDB_G0274493 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     DDB_G0274493 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     DDB_G0274493 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 HTH_15
Motif
Other DBs
NCBI-GeneID: 8619554
NCBI-ProteinID: XP_644124
dictyBase: DDB_G0274493
UniProt: Q869E1
LinkDB All DBs
Position
2
AA seq 1192 aa AA seqDB search
MQSSMWSFLQKKEGGEIEDIEKKISNAQELNKLKTSPKKKREAVVKEKVEKKEKKETKPK
RKSSKKNKEEEEEEEQEEQDGEEEQEEEEEYQQQDEEIEEDINGEEEMELDENEKEKNKK
KKQSLKTKENKESKSSSSSKKTIENKETKKPEKQSSKQSNNLKRLKRKKMDDDEEDEEDE
NKTDDNDLDDMLDDDSDNEKDSISSKDKEYKEKVLKDKEKKEKEKKEKELKEKESKEKEK
KEKEKKEKEEKDKKEKELKEKELKEKELKDKKEKELKEKEKELKDKEKKEKELKEKEKKE
KEEKEKEKKEKKEKELKEKEEKEKKEKELKEKELKEKELKEKELKEKELTSPKKETIDIS
DLFKRANAEAKSSVPTSTSKNSKTNKKQKVDHKPTATTKKPSPVLEAKQSTTTTTTTTTT
STATTISSKSISSPSKKEEKEVITSKKQVEATKVEVKKEKEKEKEKEKEDDEEEEEEEED
DDEKLEDIDEEEYEEEEEEDEEGISENEEEEEKKSTQIKSKFIKKVPISKKKGNAKTIQA
DLKVIGKYRPIEDAQWKKGEAVPYMVLAKTFEMMESTSSRLIIIEHLANLFRSIMLLSPK
DLVMTIYLSINKIGPSYQSKELGIGEHVLIKSLAESTGRSVDVIKQELTEVGDLGIIAQN
SRSTQTLMGKPTPLTIQSVFKTFQQIADLSGTGGQQKKKDLIKKLLVSCKDCETLYIIRS
LQGKLRIGLAERSVLMALAKSVLVTPPIDGSGQQIFDIRKQMKQEEFEERYQNVVSKVTR
AYSQLPNYDLFVPHLIAVNGIDNILSTCSLKVGIPVKPMLAQPTTGISQMLDRFSDMEFT
CEFKYDGERAQIHRLPDGTTHIYTRNLEDYTQKYPDIVANVTKFVGPNVKSFILDCEAVA
FDAATKKILSFQVLSTRARKSVQLSQIKVPVCVFAFDLLYLNGQSLIDEPLIKRREHLVE
NFIASDGVFAFAKYSNISDVNDIQSYLEEAVEGNCEGLMVKTLKEKSIYEPSRRSYNWLK
IKKDYMQGMTDSLDLVPIGAWYGKGKRTGTYGAYLLACYDENNEEFQTLCKIGTGFSDEQ
LTTFTSQLKPHLINQPRNQFRFSDSIKPDVWFSPSCVWEVLAADLSISPVHTAASGILDP
NKGIALRFPRFIRIRPDKSPEDATSSDQVVDMYQNQKINSQSSKINEKDEDY
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcttctatgtggagtttcttacaaaagaaagaaggtggagaaattgaagatata
gaaaagaaaattagtaatgcacaagaattaaataaacttaaaacttcccctaaaaagaaa
agagaagcagtggttaaagaaaaagttgaaaagaaagaaaaaaaagaaacaaaaccaaag
agaaagagttcaaaaaaaaataaggaagaagaagaagaagaagaacaagaagaacaagat
ggtgaagaagaacaagaagaagaagaagaatatcaacaacaagatgaagaaattgaagaa
gatataaatggtgaagaagaaatggaattagatgaaaatgaaaaagaaaagaataaaaag
aaaaaacaatcattaaaaactaaagaaaataaagaatcaaaatcatcatcttcttcaaag
aaaacaatagaaaataaagaaactaaaaaacctgaaaaacaatcttcaaaacaatcaaat
aatttgaaaagattaaaaagaaagaaaatggatgacgatgaagaagacgaagaagatgaa
aataaaactgatgataatgatttagatgatatgctcgatgatgatagtgataatgaaaaa
gattcaatttcttcaaaagataaagagtataaagaaaaagttttaaaagataaagagaaa
aaagaaaaagaaaagaaagaaaaagagttaaaagaaaaagaatcaaaggaaaaagaaaag
aaagaaaaagaaaaaaaagaaaaagaagaaaaagataaaaaagaaaaggaattaaaagaa
aaggaattaaaagaaaaggaattaaaagataaaaaagaaaaggagctaaaagaaaaagaa
aaagaactcaaagataaagagaaaaaagaaaaagagttaaaagaaaaagagaaaaaagaa
aaggaagaaaaggaaaaggagaaaaaagagaaaaaagaaaaagaattgaaagaaaaagaa
gaaaaagagaaaaaagaaaaggaattaaaagaaaaggaattaaaagaaaaggaattaaaa
gaaaaggaattaaaagaaaaggaattaacttcaccaaaaaaagaaactattgatatttca
gatttatttaaaagagcaaatgctgaagctaaatcgtcagtaccaacctcaacatctaaa
aacagtaaaactaataaaaaacaaaaagttgatcataaaccaacagcaacaacaaaaaaa
ccatcacctgtacttgaagcaaagcaaagcaccacaaccaccaccaccacaactactacc
tctaccgccacaactatttcttcaaaatcaatttcaagtccatctaaaaaagaagaaaaa
gaagtaataacttcaaaaaaacaagttgaagcaacaaaagtagaagttaaaaaagaaaaa
gaaaaagaaaaagaaaaagaaaaagaagatgatgaggaagaagaggaagaagaagaagat
gatgatgaaaaattagaagatattgatgaggaagaatatgaagaagaagaagaagaagat
gaagagggaattagtgaaaatgaagaagaagaagaaaagaaaagtacacaaattaaaagt
aaatttattaaaaaagtaccaatttcaaaaaagaaaggtaatgcaaaaactattcaagct
gatttaaaggttattggaaaatatagaccaattgaggatgcacaatggaaaaaaggtgaa
gctgtaccatatatggtattagcaaaaacctttgaaatgatggaatcaacatcatcaaga
ttaattattattgaacatttagccaatttatttagatcgattatgttattatcaccaaag
gatttggttatgacaatttatttatcaatcaataagattggtccatcctatcaatctaaa
gagttgggtattggtgaacatgttttaattaaatcattagcagagtccactggtagatca
gtggatgttattaaacaagagttgacagaggttggtgatttgggtataattgcacaaaat
agtagatccactcaaactctaatgggtaaaccaacaccattgaccattcaatcggtgttc
aaaacatttcaacaaattgctgatctctctggcacaggtggccaacaaaaaaagaaagat
cttataaagaaactattggtatcatgtaaagattgtgaaacactttatatcattcgttca
ttgcaaggtaagcttagaattggtctagccgaacgttcagtattgatggcattggctaaa
tccgtattggtaacaccaccaattgatggtagcggtcaacagatatttgatattagaaaa
caaatgaaacaagaggaatttgaagaacgttatcaaaatgttgtatcaaaggtaactcgt
gcatatagtcagttaccaaattatgatttatttgtacctcatttaattgctgtgaatggt
attgataatattttgagtacatgttcattgaaagttggtattccagtgaaaccaatgtta
gcacaaccaaccactggtatcagtcaaatgttggatcgtttctctgatatggagtttact
tgtgaattcaaatatgatggtgaacgtgctcaaatccatcgtttaccagatggtaccact
catatttataccagaaatttagaggattacactcaaaaatatccagatattgttgcaaat
gttactaaattcgttgggccaaatgtgaaatcattcattttagattgtgaagcagttgca
tttgatgctgcaacaaaaaagattttatcatttcaagttttatcgactagagcaagaaaa
agtgtacaattgtcacaaattaaagtaccagtttgtgtatttgctttcgatttactctat
ttgaatggtcaatcattaattgatgaaccattaatcaaacgtcgtgaacatttagttgaa
aatttcattgcatccgatggtgtatttgcttttgctaaatattcaaatatttccgacgta
aatgatattcaatcctatcttgaagaggctgtcgagggtaattgtgaaggtttaatggtg
aaaactttgaaagagaaatcaatctatgaaccatcacgtcgttcttacaattggttaaag
attaaaaaagattatatgcaaggtatgaccgatagtttagatttggtacccattggtgca
tggtatggtaaaggtaaaagaacaggtacttatggtgcttacttgttggcttgttatgat
gaaaacaatgaagaattccaaacactctgtaagattggtactggtttctctgatgaacaa
ttgactacttttaccagtcaattgaaacctcatctaattaatcaaccacgtaatcaattc
cgtttctctgattcaattaaacctgatgtttggttctctccaagttgtgtttgggaggta
ttggccgctgatttatcaatctctccagttcatacagctgcatctggtattttggatcca
aataaaggtatcgctttacgtttcccacgtttcattagaattcgtcctgataaatctcct
gaagatgcaactagttctgatcaagttgttgatatgtatcaaaatcaaaaaattaatagt
caatcttcaaaaattaatgaaaaagatgaagattattaa

DBGET integrated database retrieval system