KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0277289Help
Entry
DDB_G0277289      CDS       T00245                                 

Gene name
pigH
Definition
(RefSeq) phosphatidylinositol glycan, class H
  KO
K03858  phosphatidylinositol N-acetylglucosaminyltransferase subunit H
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DDB_G0277289 (pigH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-H HNF-1_N
Motif
Other DBs
NCBI-GeneID: 8620960
NCBI-ProteinID: XP_001134593
dictyBase: DDB_G0277289
UniProt: Q86K35
LinkDB All DBs
Position
2
AA seq 237 aa AA seqDB search
MEYSCIPINNDVREYKISRKDRSLITYFDLFLLFTFICTFVKHQFYSQSLFKSFSTYFLF
ALILFRFYLKFFIVKEESLIVMREIGVQLKRKYFLRPSTVVEFIEKSKIEQIVINEGITK
HNVIFYMAFIVEGKNKMVLAFEELIPRIDTLLKIYKGTQSLIFNNPTTTTTNTTATTTTN
TTPSISSPTNQTPNNITTPTLTQVNQNNNNNNNNNNSFHTSTTMSSAIDDSEDFNLK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggaatatagttgtataccaattaataacgatgttagagaatataaaatatcaagaaag
gatagatcattaataacctatttcgatctattccttttattcacttttatatgtacattt
gtaaaacatcaattctattctcaatctctatttaaatctttctcgacttatttcttgttt
gcattaattttatttagattttatttaaaattttttattgtaaaagaagaatcattaatt
gtaatgagagagataggagttcaattaaaaagaaaatattttttaagaccatcaacagtt
gtggaatttatagagaaatcaaagattgagcaaattgtaattaatgaaggtattacaaag
cataatgttatcttttacatggcattcatagttgaaggtaaaaataaaatggttttagca
tttgaagaattaataccaagaattgatacacttttaaaaatttataaagggacacaatct
ttaatatttaataatcccactactactaccacaaatacaacagcaacaacgacaacaaat
actaccccatctatttcttcaccaacaaatcaaacaccaaataacataactacaccaaca
ctaacacaagtaaatcaaaataataacaataataataataataataactcttttcatacc
tctacaacaatgtcatctgctattgatgattctgaggattttaatttaaaataa

KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_77082Help
Entry
DICPUDRAFT_77082  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K03858  phosphatidylinositol N-acetylglucosaminyltransferase subunit H
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DICPUDRAFT_77082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-H
Motif
Other DBs
NCBI-GeneID: 10500127
NCBI-ProteinID: XP_003286193
JGI: Dicpu1_77082
UniProt: F0ZFJ4
LinkDB All DBs
Position
Unknown
AA seq 239 aa AA seqDB search
MDYSCIPINNDVREYRVSRKSTSIFTFFDWFLLFTFFCTIIKHQYYNQSLFKSFSTYFLI
LLILFRFYLKLFIVKEESLIVMRELGVQLRRKYILRPERVEFIEKNKIEQIVINEGIAKH
NVIFYMAFIVEGKNKAMVLAFEDLIPRIHILLKIYRGTSSFLYTTTSSSNVPTTTTTNAT
TTTTTISSSTSSSLNISTNSTSNINPTINNINTFSSVSTSPIIGNSFTDDNIDSNFHLK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggattacagttgcataccgatcaataatgatgttagagaatacagagtctcaagaaaa
tcaacatctatatttacattttttgattggtttttactatttacattcttttgtacaatt
ataaaacaccaatattacaatcaatcattatttaaatcattttcgacatattttttaata
ttattaattctatttagattttatttaaaattatttatagttaaagaagaatcattaatt
gtaatgagagaattgggtgtacaattaagaagaaaatatattttaagacctgaaagagta
gagtttatagaaaaaaataaaattgaacagattgtaatcaatgaaggtattgcaaaacat
aatgttatattttatatggcttttattgtagagggaaaaaacaaagcaatggttttagca
ttcgaagatttaataccaaggatacatattttattaaaaatttatagaggcacctcttca
tttttatatacaacaacctcttcctccaatgtaccaactacaacaactacaaacgccaca
actacaacaactacaatatcctcaagcacttcatcctctttaaatatatcaaccaatagc
acatcaaatataaatccaaccattaataatataaatactttctcatcagtatccacttca
ccaataataggaaattcatttaccgatgataatatagatagtaattttcatttaaaatga

DBGET integrated database retrieval system