KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0278495Help
Entry
DDB_G0278495      CDS       T00245                                 

Gene name
alp
Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00730  Thiamine metabolism
ddi00790  Folate biosynthesis
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DDB_G0278495 (alp)
   00790 Folate biosynthesis
    DDB_G0278495 (alp)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DDB_G0278495 (alp)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0278495 (alp)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ddi00537]
 Enzymes
  DDB_G0278495 (alp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 8621605
NCBI-ProteinID: XP_642400
dictyBase: DDB_G0278495
UniProt: Q54Y02
LinkDB All DBs
Position
3
AA seq 559 aa AA seqDB search
MEQAPNSSSIRESGIGGGGGGGGGGNDKDEMDGSTAIPMEPMTSSSGVSSGGGGKVVSHF
LLEEDFDSKKRFTSTHKRIFYILTSLAILVTVVLLIVFLLPRGWEGPKKKTNIIMMIGDG
MGPAALTMARVCFHTKGESTSQAHLHLDPYIVGTVKTYSSNSVVTDSAAAATAYASGVKT
YNNAVGVDANGKPAGTIIEAAKKLGMKTGLVVTTRISDATPACYFAHSATRHDEAFIIDQ
LLDKEIDVILGGGKQFFSNKTLQDAVSSKYNYSYVESKQEMEQVEAGRILGLFADYNIPW
EIDRLRDPTLLSTKPSLQEMTTKALNLISQNNENGFFLMVEGSKIDVAAHINDAPTQIWE
TDAFDQTFNLVREWAEKDGNTIVIVTADHETGGLTLANQMVIDGNPKYSWSPETLLTVNK
SADLMAELIKGGADPTKLIFDNTGYTLTSDDLKEINRTKSAYYLNQVIGRIVSNYADIGF
TTGGHTGEDVNLYTFGDTISEGKFETRLKDHQTEIVDNYIDPILRGNINNIDIASFIIKT
LNLDIQSITESLKDFIPKP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagcaccaaattcatcatcaatccgtgaatcgggtattggcggtggtggtggt
ggtggtggtggtggtaatgataaagatgaaatggatggatccactgcaattccaatggag
ccaatgacatcatcatcaggtgtaagtagtggtggtggtggtaaagttgtatcccacttt
ttattagaagaagattttgatagcaagaaaagattcacaagtacacataagagaattttt
tacatattgacatcattggcaatactagtgactgttgtgttattgattgtgtttttatta
ccaagaggatgggaaggcccaaagaaaaagacaaatataattatgatgattggtgatggt
atgggaccagcagcgttgaccatggcaagagtatgttttcatacaaaaggtgagagtaca
agtcaggcacatttacatttagacccatatatagtgggcacagtgaagacatactcaagc
aacagtgtggttaccgacagtgccgcagcggcaacggcctatgcaagtggtgtcaagacg
tataataatgcagtgggtgtcgatgcaaatggcaagccagcaggcacaatcattgaggca
gctaaaaagttgggtatgaagacaggattggtcgtcacaactcgtatctctgatgcgaca
ccagcatgctatttcgcacacagcgcaacgcgtcatgacgaggcattcattatcgatcaa
ttgttggacaaggagatcgatgtgatattgggtggtggtaaacaattctttagcaataaa
acacttcaagatgctgtatcaagcaaatacaactactcgtatgttgagagtaaacaagag
atggaacaagttgaagcaggtagaattttaggactctttgcagattacaacataccttgg
gaaatcgatcgtttaagagatccaacattactttcaaccaaaccatccctacaggagatg
accaccaaagcattgaatttaatctcacaaaacaatgaaaatggtttctttttaatggtg
gaaggctcaaagattgatgtggcagctcatatcaatgacgcacccactcagatttgggag
actgatgcatttgatcaaacttttaatctagttagagaatgggcagagaaggatggtaat
accattgtaattgtgacagcagatcatgaaactggtggtcttacattagcaaatcaaatg
gttatcgatggtaatccaaaatattcatggtcaccagagacattattgacagtgaataaa
tctgctgatctcatggcagaacttatcaaaggtggtgctgatccaacgaaattgattttc
gataatacaggttacacattaacatcagatgatttaaaagaaatcaatagaaccaagtct
gcctattatctcaatcaagtgattggtcgtatcgtttcaaactatgctgatattggtttc
accactggtggtcatactggtgaggatgtcaatctctacacctttggtgatacaatctct
gaaggtaaatttgaaactcgtctaaaagatcatcaaactgaaatagttgataattatatt
gatccaatcttaagaggtaatataaataatatagatattgcttcatttatcattaaaact
ttaaatttagatattcaatcaattacagaatcattaaaagattttattcctaaaccataa

DBGET integrated database retrieval system