KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280535Help
Entry
DDB_G0280535      CDS       T00245                                 

Gene name
sdhA
Definition
(RefSeq) complex II, flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00020  Citrate cycle (TCA cycle)
ddi00190  Oxidative phosphorylation
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01130  Biosynthesis of antibiotics
ddi01200  Carbon metabolism
Module
ddi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ddi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ddi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DDB_G0280535 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DDB_G0280535 (sdhA)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DDB_G0280535 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 8622627
NCBI-ProteinID: XP_641069
dictyBase: DDB_G0280535
UniProt: Q9U3X4
LinkDB All DBs
Position
3
AA seq 626 aa AA seqDB search
MLSSALKLTKKVCSTKSNGLIRSFSTQTQSRDYAVVDHTYDAIVVGAGGAGLRAALGLTE
KGYKTACITKLFPTRSHTVAAQGGINAALGNADQDDWRWHAYDTVKGSDFLGDQDAIHYM
CKEAVPTVLELEQYGVPFSRMDDGRIYQRAFGGQSKNFGKGGQATRCCAAADRTGHALLH
TLYGQAVKHNTKFFIEYFVTDLIMENGDCRGVVAINLEDGTIHRFRSHATVIATGGYGRA
YFSATSAHTCTGDGNAMVIRAGLPCQDLEFVQFHPTGIYGSGCLITEGARGEGGYLLNSS
GERFMPRYAPSVADLASRDVVSRSETMEIREGRGVGPEKDHCLLNLTHLSPEIIDERLPG
IRETAMIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKGQVITQVDGKDKLVKGLYAAGESA
CVSVHGANRLGANSLLDIVVFGRAVANEIENTLAKDTPHKPLPPNAGEESIANIDAIRFS
NGTRSTAEIRLEMQKIMQRNAAVFRDGQVLKEGVELIDKCARSLINDLKTTDRTMIWNTD
LIESLELQNLMTQAVLTMHSAEARKESRGAHAREDYKERDDANWMKHTLSYLDVNTGKVT
LNYRPVVSETLDQSEMETIKPFKRVY
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgttatcatcagcattaaaattaactaaaaaagtttgctcaaccaaatcaaatggatta
attagaagtttttcaacacaaactcaaagtagagattatgcagttgtagatcatacatat
gatgcaattgttgttggtgcaggtggtgcaggtcttagagcagccttaggtttaacagaa
aaaggttacaagacagcatgtatcactaaattattcccaactcgttcccatacagtcgca
gcacaaggtggtattaatgctgctttaggaaatgcagatcaagatgattggagatggcac
gcatatgatacagtaaagggaagtgattttttaggtgatcaagacgccattcattacatg
tgtaaagaagcagttccaaccgttttagaattagaacaatatggtgtaccattctcacgt
atggatgatggtcgtatctatcaaagagcattcggtggtcaaagtaaaaattttggtaaa
ggtggtcaagcaactcgttgttgtgctgctgcagatcgtacaggtcatgctctcttacac
actctctatggtcaagccgttaaacataacacaaaattcttcattgagtattttgtaact
gatctcattatggaaaatggggattgccgtggtgtcgttgccatcaacttggaagatggt
accattcatcgtttcagatcacatgctaccgtcattgcaaccggtggttatggtagagcc
tatttctctgcaacctctgctcacacttgcactggtgatggtaatgctatggtcattaga
gctggtctcccatgtcaagatttagagtttgttcaattccatccaactggtatctatggt
agtggttgtttaatcaccgaaggtgctcgtggtgaaggtggttatctcctcaatagttcc
ggtgaacgtttcatgcctcgttatgccccatccgtagccgatttagcctctcgtgatgtc
gtctctcgttctgaaaccatggaaattagagaaggtcgtggtgttggtccagaaaaggat
cattgtctcctcaatctcacccatctttcaccagagattatcgatgaacgtcttccaggt
attagagagaccgctatgattttcgctggtgtcgatgtcaccaaagaaccaattccagtc
attccaaccgttcattacaatatgggtggtattccaaccaactacaaaggtcaagtcatc
actcaagtcgatggtaaagataaattagtcaaaggtctttatgccgccggtgaatctgct
tgtgtctctgtccatggtgccaatcgtttaggtgccaactctctattggatatcgttgtc
tttggtagagctgtagccaatgaaatcgaaaataccctcgccaaggataccccacacaaa
ccattaccaccaaatgctggtgaagaatcaattgcaaatattgatgccattcgtttctct
aatggtactcgttcaaccgctgaaattcgtttagagatgcaaaagattatgcaaagaaat
gctgccgtctttagagatggtcaagtcttaaaggaaggtgttgaattaattgataaatgt
gctcgttcactcataaatgatctcaaaaccaccgatcgtaccatgatttggaataccgat
ttaatcgaatcattagaactccaaaatcttatgactcaagccgtcctcactatgcactct
gctgaagcacgtaaagaaagtcgtggtgctcatgctcgtgaagattacaaagaaagagat
gatgccaactggatgaaacataccttatcctatttagatgttaatactggtaaagttacc
cttaactatcgtccagtagtttctgaaactttagatcaatctgaaatggaaactattaaa
ccattcaagagagtttattaa

DBGET integrated database retrieval system