KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281547Help
Entry
DDB_G0281547      CDS       T00245                                 

Gene name
amyA
Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00500  Starch and sucrose metabolism
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DDB_G0281547 (amyA)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DDB_G0281547 (amyA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 GHL6 DUF1966 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 8623126
NCBI-ProteinID: XP_640516
dictyBase: DDB_G0281547
UniProt: Q54TS5
LinkDB All DBs
Position
3
AA seq 470 aa AA seqDB search
MNKTISVVIFALIAIVSVTLAATPDQWGSRTIYQLLTDRFSQTVNSSQPCGNLQGYCGGT
FQGVEAHLDYIQGMGFDAIWISPVVTNTPGGYHGYWQQDIYTVNEYFGTENDLLNMIKAC
HERGIWVMLDVVANHVGPVNYDYSTIVPFDSVEHYHNCTTCPQYCTIDDFTNYPQVEECR
LSGLPDLDQDNQFVRTTLQAWIKNMTEFYGFDGIRIDTVPEVKADFWREYNDAAGVYAVG
EVYNGNLTYVASYQGPVDGVLSYPMFFTLRSVFAQQQSMNQIQSTFQSYQQLFSNMSLLG
TFIDNHDQVRFLNEQSDIELYKNAITYVLMAQGIPIIYYGTEQGFNGASDPNNREPLWTT
SFNTASPLYQFIQTVNTFRANITEDLTIAQVQRYSDNGFYAFTRGNAFVALTNGGSNEVQ
TSRNITYHPYLEGTTLCNIFYPTEDCIKVAGGAFTVYLDHGESKIYYPMN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacaatttcagttgtaatttttgctttaattgctattgttagtgtaacatta
gcagcaacaccagatcaatggggttcaagaactatttatcaacttttaaccgatagattc
agtcaaactgtcaatagttctcaaccatgcggtaatcttcaaggctattgtggtggtaca
ttccaaggtgtcgaagctcatttagattatatccaaggtatgggttttgatgcaatttgg
atttcaccagttgttacaaatacaccaggtggttatcatggttattggcaacaagatatt
tatacagtaaatgaatatttcggaacagaaaatgatttattaaatatgattaaagcatgt
catgaaagaggtatttgggttatgttagatgttgttgcaaatcatgttggtccagttaat
tatgattattcaaccattgttccatttgattcagttgaacattatcacaattgtactaca
tgtccacaatattgtaccattgatgatttcaccaattatccacaagttgaagaatgtcgt
ttatcaggtttaccagatttagatcaagataaccaattcgttagaacaacactccaagca
tggattaaaaatatgacagaattctatggtttcgatggtattcgtatcgatacagtacca
gaggttaaagctgatttctggagagaatataacgatgccgccggtgtttacgcagttggt
gaagtttacaatggaaatttaacctatgttgcctcataccaaggtccagtcgacggtgtt
ttatcctacccaatgtttttcactcttcgttcagtttttgctcaacaacaatcaatgaat
caaattcaatccactttccaatcctatcaacaactctttagcaacatgtcattgttgggt
acctttattgataatcacgatcaagtacgtttccttaatgagcaatccgatattgaactc
tacaagaatgccatcacctacgttttaatggctcaaggtatcccaatcatttactatggc
actgaacaaggtttcaatggtgcttccgatccaaacaatcgtgagccattatggaccacc
tctttcaataccgcttccccactctatcaattcattcaaaccgttaatacattccgtgct
aatatcaccgaagatttaacaattgctcaagttcaacgttactctgataatggtttctac
gctttcactcgtggtaatgcttttgttgccttaacaaatggtggttcaaatgaagttcaa
actagtcgtaacattacttatcacccataccttgaaggtaccactctttgtaacatcttt
tatccaactgaagattgtattaaagttgctggtggtgctttcactgtttatctcgatcat
ggtgaatcaaagatttattatccaatgaattaa

DBGET integrated database retrieval system