KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0282007Help
Entry
DDB_G0282007      CDS       T00245                                 

Gene name
uch1
Definition
(RefSeq) peptidase C12 family protein
  KO
K05609  ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ddi01002]
    DDB_G0282007 (uch1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ddi04121]
    DDB_G0282007 (uch1)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DDB_G0282007 (uch1)
Peptidases and inhibitors [BR:ddi01002]
 Cysteine peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   DDB_G0282007 (uch1)
Ubiquitin system [BR:ddi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    DDB_G0282007 (uch1)
  UBL-specific proteases (ULPs)
   DDB_G0282007 (uch1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 8623358
NCBI-ProteinID: XP_640403
dictyBase: DDB_G0282007
UniProt: Q54T48
LinkDB All DBs
Position
3
AA seq 255 aa AA seqDB search
MSVDQELIETQKNWIPLEANPEVLTTFMQSLGVSKDWEFCDIYGIDEGLLEMVPSPCVAV
ILLFPITNEYEDKRYKLEKEIEEKGQVLSDKVYFMKQYIGNACGTIGVIHSVLNNANVIE
FNENGFFKQFLDKTTSLSTEERAISLLKNSEIEKSHEISALQGQSNVPQEDEPVVLHFVS
FVHVDGHLYELDGRKPFAINHGESSAETLLKDTANVLQKMIDEDPKEIRFNLMGLVKKPN
EESEEEEEKEKEETK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtagatcaagaattaattgaaactcaaaagaattggatcccattagaagcaaat
ccagaagtattaacaacatttatgcaaagtttaggagtttctaaagattgggaattctgt
gatatatatggtattgatgaaggtttacttgaaatggtaccatcaccatgtgtagctgta
attttattattcccaatcaccaatgaatatgaagataaaagatataaattagagaaagag
attgaagagaaaggtcaagttttatcagataaagtttattttatgaaacaatatattgga
aatgcatgtggtacaattggtgtgattcattcagtattaaacaatgcaaatgttattgaa
tttaatgaaaatggtttctttaaacaatttttagataaaaccacatcactttcaactgaa
gagagagcaatctcacttttgaaaaatagtgaaatcgaaaaatctcatgaaatctctgca
cttcaaggtcaaagtaatgtaccacaagaagatgaacctgtagttttacattttgtttca
tttgttcatgttgatggacatttatatgaattagatggtagaaaaccatttgcaattaat
catggtgaatcaagtgctgaaacattattaaaagatacagctaatgttttacaaaagatg
attgatgaagatccaaaagaaattagatttaatttaatgggtttggttaaaaaaccaaat
gaagaaagtgaggaagaagaagaaaaagaaaaagaagaaacaaaataa

DBGET integrated database retrieval system