KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283867Help
Entry
DDB_G0283867      CDS       T00245                                 

Gene name
cprC
Definition
(RefSeq) cysteine proteinase 3
  KO
K01365  cathepsin L [EC:3.4.22.15]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    DDB_G0283867 (cprC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ddi01002]
    DDB_G0283867 (cprC)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ddi03110]
    DDB_G0283867 (cprC)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ddi00537]
    DDB_G0283867 (cprC)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.15  cathepsin L
     DDB_G0283867 (cprC)
Peptidases and inhibitors [BR:ddi01002]
 Cysteine peptidases
  Family C1: papain family
   DDB_G0283867 (cprC)
Chaperones and folding catalysts [BR:ddi03110]
 Intramolecular chaperones
  Papain family
   DDB_G0283867 (cprC)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ddi00537]
 Others
  DDB_G0283867 (cprC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 8624257
NCBI-ProteinID: XP_638859
dictyBase: DDB_G0283867
UniProt: Q23894
LinkDB All DBs
Position
4
AA seq 337 aa AA seqDB search
MRLSITLIFTLIVLSISFISAGNVFSHKQYQDSFIDWMRSNNKAYTHKEFMPRYEEFKKN
MDYVHNWNSKGSKTVLGLNQHADLSNEEYRLNYLGTRAHIKLNGYHKRNLGLRLNRPQFK
QPLNVDWREKDAVTPVKDQGQCGSCYSFSTTGSVEGVTAIKTGKLVSLSEQNILDCSSSF
GNEGCNGGLMTNAFEYIIKNNGLNSEEQYPYEMKVNDECKFQEGSVAAKITSYKEIEAGD
ENDLQNALLLNPVSVAIDASHNSFQLYTAGVYYEPACSSEDLDHGVLAVGMGTDNGEDYY
IVKNSWGPSWGLNGYIHMARNKDNNCGISTMASYPIA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagattatcaattacattaatttttacattaattgttttatcaattagttttatttca
gcaggaaatgttttttcccacaagcaatatcaagattcattcattgattggatgagatca
aataataaagcttatactcataaagagtttatgccaagatatgaagaatttaaaaagaat
atggattatgttcataattggaattccaaaggatcaaaaactgttcttggtttaaatcaa
catgctgatttatcaaatgaagaatatagattaaattaccttggtactagagctcacatt
aaattaaatggttatcataaacgtaatttaggtttaagattaaatcgtccacaatttaaa
caaccattaaatgttgattggagagaaaaggatgctgtaactccagttaaagatcaaggc
caatgtggtagttgttattcattctctacaactggttcagttgaaggtgtaactgcaatt
aaaactggtaaattagtatcattatctgaacaaaatattttagattgttcttcatctttt
ggtaatgaaggttgtaatggtggtttaatgacaaatgcattcgaatatattattaaaaat
aatggtttaaatagcgaagaacaatacccatacgaaatgaaagttaacgatgaatgtaaa
ttccaagagggtagtgttgctgccaagattacatcatataaagaaattgaagcaggcgat
gaaaacgatttacaaaatgctttacttttaaatccagtctcagttgctattgatgcttct
cataatagtttccaactttacactgccggtgtttactatgaaccagcttgttcttctgaa
gatttagatcatggtgtacttgctgttggtatgggtactgataatggtgaagattattac
attgttaaaaatagttggggaccatcatggggtttaaatggttatattcatatggcaaga
aataaagataacaattgtggaatctcaacaatggcttcatatcctattgcttaa

DBGET integrated database retrieval system