KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283921Help
Entry
DDB_G0283921      CDS       T00245                                 

Gene name
ctsB
Definition
(RefSeq) cathepsin B precursor
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ddi01002]
    DDB_G0283921 (ctsB)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ddi03110]
    DDB_G0283921 (ctsB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0283921 (ctsB)
   00536 Glycosaminoglycan binding proteins [BR:ddi00536]
    DDB_G0283921 (ctsB)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     DDB_G0283921 (ctsB)
Peptidases and inhibitors [BR:ddi01002]
 Cysteine peptidases
  Family C1: papain family
   DDB_G0283921 (ctsB)
Chaperones and folding catalysts [BR:ddi03110]
 Intramolecular chaperones
  Papain family
   DDB_G0283921 (ctsB)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   DDB_G0283921 (ctsB)
Glycosaminoglycan binding proteins [BR:ddi00536]
 Heparan sulfate / Haparin
  Others
   DDB_G0283921 (ctsB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 CAMSAP_CKK
Motif
Other DBs
NCBI-GeneID: 8624329
NCBI-ProteinID: XP_638805
dictyBase: DDB_G0283921
UniProt: Q54QD9
LinkDB All DBs
Position
4
AA seq 311 aa AA seqDB search
MRVLLSLVVILFIINSAFAVKINIGRPTKSHKTIHHETWVEEQTDQFDNIKVGQLLGFKR
SPNRPKLQIKSYDPLGVQIPTSFNAQTNWPNCTTISQIQNQARCGSCWAFGATESATDRL
CIHNNENVQLSFMDMVTCDETDNGCEGGDAFSAWNWLRKQGAVSEECLPYTIPTCPPAQQ
PCLNFVNTPSCTKECQSNSSLIYSQDKHKMAKIYSFDSDEAIMQEIVTNGPVEACFTVFE
DFLAYKSGVYVHTTGKDLGGHCVKLVGFGTLNGVDYYAANNQWTTSWGDNGTFLIKRGDC
GISDDVVAGLP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagagtattattatcattagttgtaattttattcattataaattcagcctttgctgta
aagattaatattggtcgtccaaccaaatcacataaaactatccatcacgaaacttgggta
gaagaacaaactgatcaattcgataatattaaagttggccaattattaggtttcaagaga
agtccaaacagaccaaaacttcaaattaaatcttatgatccattaggagttcaaattcca
acttctttcaatgctcaaaccaactggccaaattgtactaccattagtcagattcaaaat
caagcaagatgtggttcttgttgggcttttggtgctacagaatcagctactgatcgttta
tgtattcacaataatgaaaatgttcaattaagttttatggatatggttacttgtgatgaa
actgataacggttgtgaaggtggtgatgccttctctgcatggaattggttaagaaagcaa
ggtgctgtatcagaagaatgtcttccatatacaattccaacttgtccaccagctcaacaa
ccatgtttaaattttgtcaacactccatcatgtactaaagagtgtcaatcaaattcctct
ttaatttattctcaagacaaacataaaatggctaaaatttattctttcgactctgatgaa
gcaatcatgcaagaaattgttactaatggtccagtcgaagcttgtttcactgtctttgaa
gatttccttgcttacaaatctggtgtttacgtccacacaactggtaaagatttaggtggt
cactgtgttaaactcgttggtttcggtaccttaaatggtgttgattactatgccgctaac
aaccaatggacaacttcatggggtgataatggaactttcttaatcaaacgtggtgattgc
ggtatctctgatgacgttgttgctggtttaccataa

DBGET integrated database retrieval system