KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283965Help
Entry
DDB_G0283965      CDS       T00245                                 

Gene name
pigA
Definition
(RefSeq) GlcNAc transferase
  KO
K03857  phosphatidylinositol N-acetylglucosaminyltransferase subunit A [EC:2.4.1.198]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DDB_G0283965 (pigA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ddi01003]
    DDB_G0283965 (pigA)
Enzymes [BR:ddi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.198  phosphatidylinositol N-acetylglucosaminyltransferase
     DDB_G0283965 (pigA)
Glycosyltransferases [BR:ddi01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   DDB_G0283965 (pigA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIGA Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_4_2 Glyco_trans_1_2 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 8624356
NCBI-ProteinID: XP_638832
dictyBase: DDB_G0283965
UniProt: Q54QB2
LinkDB All DBs
Position
4
AA seq 523 aa AA seqDB search
MDQQHQNQSQQNNTIEINNNNNNNNNNNIVNNNNNIDSIDNNNIVNINNNNNNNNNNNIN
NVNNYNINNNNIANFNYNNNNNNNNGERKYRIAMVSDFFYPNMGGVEEHLYQLSQCLIKR
GNKVIIITHSYGDRFGIRYVTNGLKVYYIPQAPFYNQSSFPTLYFTFPLFRKILIRERIE
IVHCHQAFSTLAHESILHARTMGYSTCFTDHSLFGFADASSIHMNKLLKFTLSDISHVIC
VSNTSKENTVLRAQLDPHLVSVIPNAVDTTQFTPDPSKRDPNKLTIVIMSRLVYRKGIDL
IIDIIPNICKKFPNAYFVIGGDGPKRVSLEEMREKHQLHDRVELLGSVKHSNVRNVLVRG
DIFLNSSLTEAFCIAIVEAASCGLYVVSTKVGGVPEVLPPHMISLAQPKSDDLEEKLTDA
IINLKSTPLQTHEEVRTMYDWNDVARRTETVYDIISKAPKVPFIERLRRFVGCGLWAGKL
NCMVVALDNLIYRCLEYYSPKEDIDEAFDFPIEGYTKFKQQIK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacaacaccaaaaccaatcacaacaaaataatacaattgaaataaataataat
aataacaataataataataataatatagtgaataataataataatatagatagtatagat
aataataatatagttaatattaataataataataataataataataataataatataaat
aatgtaaataattataatataaataataacaatatagcgaattttaattataataataat
aataataataataatggtgaaagaaaatataggattgccatggtttcagatttcttttat
ccaaatatgggtggtgttgaagaacatctttatcaattatcacaatgtttaattaagaga
ggaaataaagttataatcattacacatagttatggtgatagatttggtataagatatgtt
acaaatggtttaaaagtttattatatacctcaagcaccattttataatcaatcttctttt
cctacattatatttcactttcccattatttagaaagattttaatacgtgaaagaattgaa
attgtacattgtcatcaagcattttcaacacttgcacatgaaagtattttacatgcaaga
actatgggatatagtacatgttttacagatcattcattatttggttttgcagatgcaagt
tcaatacatatgaataaactattaaaatttacattatcagatatatcacatgttatttgt
gtatcaaatacaagtaaagagaatactgtattaagagctcaattagatcctcatttagta
tctgtaattccaaatgctgttgatactactcaatttacacccgatccttcaaaaagagat
ccaaataaattaacaattgtaattatgagtagattagtttatagaaaaggtattgattta
attattgatattataccaaatatttgtaagaaatttccaaatgcatattttgtaattggt
ggtgatggtccaaaacgtgtatcattagaagagatgagagagaaacatcaacttcatgat
agagttgaattattgggaagtgttaaacattcaaacgttagaaatgtgttggttagaggt
gacatttttttaaattcatcattgactgaagcattttgtattgcaattgttgaagctgca
agttgtggtctatatgtggtcagtacaaaggttggtggtgttccagaggtattaccaccc
catatgatatcattggcacaaccaaagagtgacgatttagaagagaaactaactgatgca
atcattaatctaaaatcaacacctttacaaacccatgaagaagttagaacaatgtatgac
tggaacgatgtcgcacgtcgtactgaaacagtatatgatatcattagtaaagctccaaag
gtgccatttattgaaagattacgtcgtttcgttggttgtggtctttgggctggaaaatta
aattgtatggtggttgcacttgataatttaatttatcgttgtttagaatattattcacca
aaagaagatattgacgaagcttttgattttccaattgaaggttatacaaaatttaaacaa
caaattaaataa

KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_148633Help
Entry
DICPUDRAFT_148633 CDS       T02090                                 

Definition
(RefSeq) GlcNAc transferase
  KO
K03857  phosphatidylinositol N-acetylglucosaminyltransferase subunit A [EC:2.4.1.198]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DICPUDRAFT_148633
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dpp01003]
    DICPUDRAFT_148633
Enzymes [BR:dpp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.198  phosphatidylinositol N-acetylglucosaminyltransferase
     DICPUDRAFT_148633
Glycosyltransferases [BR:dpp01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   DICPUDRAFT_148633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIGA Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_4_2 Glyco_trans_1_2 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 10506841
NCBI-ProteinID: XP_003284836
JGI: Dicpu1_148633
UniProt: F0ZBL7
LinkDB All DBs
Position
Unknown
AA seq 468 aa AA seqDB search
MEQAQYNEYNNIENINNNIQGLLINNNNERKYRIAMVSDFFYPNMGGVEEHLYQLSQCLI
KRGNKVIIITHSYGDRFGIRYVTNGLKVYYIPQAPFYNQSSFPTLYFTFPLFRKILIRER
IEIVHCHQAFSTLAHESILHARTMGYSTCFTDHSLFGFADASSIHMNKLLKFTLSDISHV
ICVSNTSKENTVLRAQLDPHLVSVIPNAVDTTQFTPDPSKRDPNKISIVIMSRLVYRKGI
DLVIDIIPNICKKFPNAHFIIGGDGPKRVSLEEMREKHQLHDRVELLGSVKHSNVRNVLV
RGDIFLNSSLTEAFCIAIVEAASCGLYVVSTKVGGVPEVLPPHMISLAQPKSDDLEEKLT
EAIIKLKINPMETHEEVRSMYDWNDVARRTETVYDIISKAPKVPFIERLRRFVGCGLWAG
KLNCMVVALDSLVYKFLEYYSPKEDIDEAFDFPIEGYTQYKNNQLKNN
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagcacaatacaatgaatataataatatagagaatataaataataacatacag
ggcctattaataaataataataatgaaaggaaatatagaatagcaatggtatcagatttc
ttctatccaaatatgggtggtgtcgaagagcatttatatcagctatcacaatgcctcatc
aagagaggaaataaagttattatcataacacatagctatggcgatagatttggtataaga
tatgtgaccaatggtttaaaagtttattatattccacaagcaccattttacaatcaatca
tcattcccaacattatactttacatttccactatttagaaaaattttaattagagaaaga
attgaaattgttcattgtcatcaagcattttcaacacttgcacatgaaagtattttacat
gcaagaactatgggatacagcacttgttttactgatcactcattatttggttttgcagat
gcaagttcaatccatatgaataaattattaaaatttacactatcagatatttcccatgtt
atttgtgtatcaaatacaagtaaagagaatacagtattaagagcccaactggatccacat
ttagtcagtgttattccaaacgcagtagatacaacccaattcacacccgatccatcaaaa
agagatcctaataaaatttcaattgtaattatgagtagattagtttatagaaaaggtatt
gatttggtaattgatattataccaaatatttgtaaaaaattcccaaatgcacattttatt
attggtggagatggacccaaaagagtatcattggaagaaatgagagaaaaacatcaactt
cacgatcgtgttgaattactgggtagtgttaaacattcaaacgttagaaatgtattagtt
agaggcgacatctttttaaattcatcactcaccgaagcattttgtattgcaattgttgaa
gcagcatcgtgtggtctttatgtagtcagtaccaaagtaggtggtgtacccgaagtatta
ccaccacatatgatttcattagcccaaccaaaaagcgatgacttggaagaaaaactcact
gaagcaattattaaacttaaaatcaatccaatggaaacccacgaagaagtccgttcaatg
tacgactggaacgatgtagcaagacgtaccgaaacagtttacgatattatatctaaagca
cccaaagttccattcatcgaaagattacgtcgttttgttggttgtggtctttgggctgga
aagttaaattgtatggttgtagcactagatagtttggtttataaatttttagaatattat
tcgcctaaagaagatatcgacgaagcatttgatttcccaatcgaaggttatactcaatat
aaaaacaatcaactaaaaaacaattaa

DBGET integrated database retrieval system